SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000010013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000010013
Domain Number 1 Region: 141-381
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-84
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 49-147
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-16
Family Hepsin, N-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 6-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000010013
Sequence length 385
Comment (Macaca mulatta)
Sequence
VKVILDKYYFLCGQHLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRST
LQVLDPATGNWFSACFDNFTAALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQ
ELHVRNSSGPCLSGSLVSLHCLACGESLKTPRVVGGKEASVDSWPWQVSIQYDKQHVCGG
SILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIA
LMKLQLPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVID
SIRCNADDAYQGEVTEKMVCAGIPEGGVDTCQGDSGGPLMYQSDQWQVVGIVSWGYGCGG
PSTPGVYTKVSAYLNWIYNVRKAEL
Download sequence
Identical sequences ENSMMUP00000010013 9544.ENSMMUP00000010013 ENSMMUP00000010013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]