SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000010369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000010369
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000275
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000010369
Sequence length 227
Comment (Macaca mulatta)
Sequence
MASPSRQPPPGGSGLLHGSRARSYGSLVQSACSPVRERRLEHHLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVRPSNDEVWPHS
TERKKQETGAGRANGEVFPTLGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGE
SGVPGEDAGLHLSSPRMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences F7AZF7
9544.ENSMMUP00000010369 ENSMMUP00000010369 ENSMMUP00000010369 XP_015007450.1.72884 XP_015007457.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]