SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012035 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012035
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-21
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012035
Sequence length 239
Comment (Macaca mulatta)
Sequence
VTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTDETGGLTSVTWSFQPEGADTTVSFFHY
SQGQVYPGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHI
RLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLS
PVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Download sequence
Identical sequences 9544.ENSMMUP00000012035 ENSMMUP00000012035 ENSMMUP00000012035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]