SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012866 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012866
Domain Number 1 Region: 284-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 184-274
Classification Level Classification E-value
Superfamily PKD domain 0.000000017
Family PKD domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012866
Sequence length 476
Comment (Macaca mulatta)
Sequence
XLLLCLWLPSGRAALPPAAPLSELHAQLSGVGQLLEEFRRQLQQERPQEELELELRSGGG
PQEDCPGPGGGGYSAMPDAIIRTKDSLAAGASFLRAPAAVRGWRQCVAACCSEPRCSVAV
VELPRRPSPPAAVLGCYLFNCTARGRNVCKFALHRGYSSYSLSRAPDGAALATARASPRL
EKDAPPLSKAGQDVVLHLPTDGVVLDGRESTDDHAIVQYEWALLQGDPSVDMKVPQSGTL
KLSHLQEGTYTFQLTVMDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHFFCDDGCCID
ITLACDGVQQCPDGSDEDFCQNLGLDRKMVTHVVASPALPGTTGPSEDAGVDSLVEKSQK
ATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPDSSSSRKDRKEENYIFESKGDGGGGEH
PAPETGAVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEESDYLINGMYL
Download sequence
Identical sequences ENSMMUP00000012866 9544.ENSMMUP00000012866 ENSMMUP00000012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]