SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000012945 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000012945
Domain Number 1 Region: 1262-1527
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-52
Family YWTD domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 1882-2127
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-47
Family YWTD domain 0.0000236
Further Details:      
 
Domain Number 3 Region: 530-792
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-47
Family YWTD domain 0.00000537
Further Details:      
 
Domain Number 4 Region: 205-461
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-42
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 5 Region: 1577-1834
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-42
Family YWTD domain 0.000023
Further Details:      
 
Domain Number 6 Region: 3017-3272
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-41
Family YWTD domain 0.0000202
Further Details:      
 
Domain Number 7 Region: 2191-2458
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-32
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 8 Region: 3893-4171
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-31
Family YWTD domain 0.0000533
Further Details:      
 
Domain Number 9 Region: 2928-3009,3265-3326
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.16e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1165-1254,1528-1572
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000683
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 11 Region: 103-193,786-835
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000534
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 12 Region: 877-922
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 13 Region: 3800-3917,4163-4219
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 14 Region: 3759-3799
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 3633-3669
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 16 Region: 921-959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 842-881
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 18 Region: 3594-3631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 3554-3589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 20 Region: 2761-2797
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 21 Region: 3675-3720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 22 Region: 3472-3512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 23 Region: 3354-3398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 24 Region: 2892-2933
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 1006-1044
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00024
Further Details:      
 
Domain Number 26 Region: 1054-1090
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 27 Region: 2682-2718
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 2547-2588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 29 Region: 2803-2839
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 3511-3551
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 31 Region: 3317-3352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 2588-2627
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 3437-3473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 3396-3433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 35 Region: 2721-2763
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 36 Region: 1836-1886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.014
Further Details:      
 
Domain Number 37 Region: 31-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000126
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 38 Region: 2512-2549
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 39 Region: 2841-2881
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 40 Region: 2641-2677
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 41 Region: 965-1005
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 42 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 43 Region: 76-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000903
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 44 Region: 1100-1133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000982
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 45 Region: 2146-2195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 46 Region: 3721-3753
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000759
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 47 Region: 4396-4430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000914
Family EGF-type module 0.047
Further Details:      
 
Domain Number 48 Region: 4290-4325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000035
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000012945
Domain Number - Region: 4254-4291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4217-4253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000323
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 483-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000726
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 2466-2527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0789
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000012945
Sequence length 4601
Comment (Macaca mulatta)
Sequence
MSEFLLALLTLSGLLPIARVLTVRADRDQQLCDPGEFLCHDHVTCVSQSWLCDGDPDCPD
DSDESLDTCPEEVEIKCPLNHIACLGTNKCVHLSQLCNGVLDCPDGYDEGVHCQELLPNC
QQLNCQYKCTMVGNSTRCYCENGFEIKEDGRSCKDQDECAVYGTCSQTCRNTHGSYTCSC
VEGYLMQSDNRSCKAKIEPTDRPPILLIANFETIEIFYLNGSKMATLSSVNGNEIHALDF
IYNEDMICWIESRESSNQLKCIQITKAGGLTDEWTINILQSFHNVQQMAIDWLTRNLYFV
DHVSDRIFVCNYNGSVCITLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERCDMDGMN
RTRIIDSKTEQPAALALDLVNKLVYWVDLYLDYVGVVDYQGKNRHAIIQGRQVRHLYGIT
VFEDYLYATNSDNYNIIRINRFNGTDIHSLIKMENARGIRIYQKRTQPTVRSHACEVDPY
GMPGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDL
NTKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETILKDDLDN
VEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPINGWMY
WTDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIE
KVFLNGTHRKIVYSGRELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITSEVTLLRHERPP
LFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEA
LPRICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQNNRCIP
KRWLCDGANDCGSNEDESNQTCAARTCQVDQFSCGNGRCIPRAWLCDREDDCGDQTDEMA
SCEFPTCEPLTQFVCKSGRCISSKWHCDSGNNDDCGDGSDEVGCVHSCFDNQFRCSSGRC
IPGHWACDGDNDCGDFSDEAQINCTKEEIHSPAGCNGNEFQCHPDGNCIPDLWRCDGEKD
CEDGSDEKGCNGTIRLCDHKTKFSCWSTGRCINKAWVCDGDIDCEDQSDEDDCDSFLCGP
PKYPCANDTSVCLQPEKLCNGKKDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCS
CPEGLQLNKDNKTCEIVDYCSNHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTSVDPF
EAFIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLS
ESGGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAME
HPRAIALDPRYGILFWTDWDANFPRIESASMSGAARKTIYKDMKTGAWPNGLTVDHFEKR
IVWTDARSDAIYSALYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKW
TGQNVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAACACPH
LMKLSSDKKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEE
RLYWTDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEYDETQINVA
RLDGSLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGL
SIDYVENKLYWISSGNGTINRCNLGGGNLEVIESMKEELTKATALTIMDKKLWWADQNLA
QLGTCSKRDGRNPTILRNKTSGVVHMKVYDKEAQQGNNSCQLNNGGCSQLCLPTSETTRT
CMCTVGYYLQKNRMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVGIDFH
AENDTIYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGIAIDWIAGNIYWTDHGFNLIE
VARLNGSFRYVIISQGLDQPRSIAVHPEKGLLFWTEWGQMPCIGKARLDGSEKVVLVSMG
IAWPNGISIDYEENKLYWCDARTDKIERIDLETGGHREVVLSGSNVDMFSVAVFGAYIYW
SDRAHANGSVRRGHKNDATETITMRTGLGVNLKEVKIFNRVREKGTNVCARDNGGCKQLC
LYRGNSQRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYENP
HYFKNVIALAFDYNQRRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGLAYHR
AWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVITMSEDDHPHVLALDECQNLMFWTNWN
EQHPSIMRSTLTGKNAQVVVSTDILTPNGLTIDYRAEKLYFSDGSLGKIERCEYDGSQRH
VIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGIIAVAN
DTNSCELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLEDNRCVTKNSSCNIYSEFEC
GNGECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNRRCIPHGKLCDGENDCG
DNSDELDCKVSTCATVEFRCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFYKLGV
KTTGFIRCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYFSCPSGRCILTT
WICDGQQDCEDGLDEFHCDSSCSWNQFACSAQKCISKHWICDGEDDCGDGLDESDSICGA
VTCAADMFSCQGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCHNKVCI
PKQFVCDHDDDCGDGSDESSQCGYRQCGTEEFSCADGRCLLNTQWQCDGDFDCPDHSDEA
PLNPKCKSAEQSCNSSFFMCKNGRCIPSGGLCNNKDDCGDGSDERNCHINECLSKKVSGC
SQDCQDLPISYKCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCVNTYGTYKCLCTDGYE
TQPDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIY
WIDSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNG
LYPTILVSKRLKFPRDLSLDPRAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMA
LTIDYVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLS
RAHKTSGADRLSLINSWHAITDIQVYHSYRQPDVSKHLCMINNGGCSHLCLLAPGKTHTC
ACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQ
PGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNG
QDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGP
HEFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDF
DCADGSDERNCEISCSKDQFQCSNGQCIPAKWKCDGHEDCKYGEDEKSCEPASPTCSSSE
YICASGGCISASLKCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDGIHDC
VDGSDEENCDRGGNICRADEFLCNNSLCKLHSWVCDGEDDCGDNSDEAPDMCVKFICPST
RPHRCRNNRICLQSEQMCNGIDDCGDNSDEDHCTGKLTYKARPCKKDEFACSNKKCIPMD
LQCDRLDDCGDGSDEQGCRIAPTEYTCEDNVNPCGDDANCNQIKTSVFCRCKPGFQRNMK
HRQCEDLNECLVFGTCSHQCINVEGSYKCVCDQNFQERNNTCIAKGSEDQVLYIANDTDI
LGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGREKRQ
TNSGLICPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNC
TRLLTNMAGEPYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNLQRPTGLAV
DYFSERIYWADFELSIIGSVLYDGSNSIVSVSSKQGLLHPHRIDIFEDYIYGAGPKNGVF
RVQKFGHGSVEYLALNIDKTKGVLISHRYKQLDLPNPCSDLACEFLCLLNPSGATCVCPE
GKYLINGTCNDDSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGERCEVNHCSNYCQ
NGGTCVPSVLGRPTCSCALGFTGPNCGKTVCEDFCQNAGTCIVTAGNQPYCHCQPEYTGD
RCQYYVCHYYCVNSESCTIGDDGSVECVCPTRYEGPKCEVDKCVRCHGGHCIINKDSEDI
LCNCTNGKIASSCQLCDGYCYNGGTCQLDPETNVPVCLCSTNWSGTQCERPAPKSSKSDH
ISTRSIAIIVPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYNMY
EVDHDHSDGGLLDPGFMIDPTKARYIAGGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYS
NPVYAKLYMDGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences ENSMMUP00000012945 ENSMMUP00000012945 9544.ENSMMUP00000012945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]