SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000013440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000013440
Domain Number 1 Region: 1109-1401
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.47e-69
Family Protein kinases, catalytic subunit 0.00000053
Further Details:      
 
Domain Number 2 Region: 476-633
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000728
Family MAM domain 0.043
Further Details:      
 
Domain Number 3 Region: 262-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000332
Family MAM domain 0.0068
Further Details:      
 
Domain Number 4 Region: 437-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000013440
Sequence length 1619
Comment (Macaca mulatta)
Sequence
MGTIGLLWLLPLLLSTAALGSGTGTGQRTGSPAAGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPPSPSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPTPAEA
RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ
GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNIPSPSPDY
FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRVPSEEASQ
MDLLDGPEAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQICRKLPVGFYC
NFEDGFCGWTQGTLSPHTPQWQVRTLNDARFQDHQDHALLLSTTDASTSESATVTSATFP
APIKSSPWELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWTVLPL
LDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP
NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPL
KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGE
DACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDAFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLLEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDTESHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSQPPP
PPHFPFSAQTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAG
GDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPG
PGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWE
IFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILE
RIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKRGEERSPAAP
PPVPTTSSGKAAKKPTAAEVSVRVPRGPAVEGGHVNMAFSQSNPPSELHKVQGSRNKPTS
LWNPTYGSWFTEKPTKKNNPLAKKEPHERGNLGLEGSCTVPPNVATGRLPGASLLLEPSS
LTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
Download sequence
Identical sequences ENSMMUP00000013440 9544.ENSMMUP00000013440 ENSMMUP00000013440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]