SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000019858 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000019858
Domain Number 1 Region: 31-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000158
Family Complement control module/SCR domain 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000019858
Sequence length 266
Comment (Macaca mulatta)
Sequence
MAPRRARGSRTLGLPALLLLLLLRPPATRGITCPPPVSVEHADIRVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNIAHWTTPSLKCIRDPLLARQRPALPFTVTTAGVTPQPE
SLSPSGKEPAASSPSSNTTAATTAAIVPSSRLMPSTSSSTGTTEIGSHESSHGPSQTTAK
TWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYIKSRQTPPPASIEM
EAMEALPVTGETSSRDEDLENCSHDL
Download sequence
Identical sequences ENSMMUP00000019858 9544.ENSMMUP00000019858 ENSMMUP00000019858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]