SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000024061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000024061
Domain Number 1 Region: 13-178
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-32
Family C-type lectin domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000024061
Sequence length 180
Comment (Macaca mulatta)
Sequence
TVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSVEPAYTPGPNIELQKDSDCCSC
HEKWVGYRCNCYFISSEEKTWNESRHFCASQKSSLLQLQNRDELALDFMSSSQHFYWIGL
SYSEEHTAWLWENGSALSQDLFPSFETFKPKNCIAYNSKGNALDESCETKNRYICKQQLI
Download sequence
Identical sequences ENSMMUP00000024061 ENSMMUP00000024061 9544.ENSMMUP00000024061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]