SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000025813 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000025813
Domain Number 1 Region: 31-125
Classification Level Classification E-value
Superfamily POZ domain 1.96e-27
Family Tetramerization domain of potassium channels 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000025813
Sequence length 314
Comment (Macaca mulatta)
Sequence
EEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMF
SGRMEVLTDSEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLV
EECQAALQNKDTYEPFCKVPVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDN
MLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKIAEVCCTSIVYATEKKQTK
VEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERERIERVRR
IHIKRPDDRAHLHQ
Download sequence
Identical sequences ENSMMUP00000025813 ENSMMUP00000025813 9544.ENSMMUP00000025813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]