SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000028683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000028683
Domain Number 1 Region: 3027-3285
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-57
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 1269-1534
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 3 Region: 3628-3899
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-44
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 4 Region: 1584-1841
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-43
Family YWTD domain 0.0000242
Further Details:      
 
Domain Number 5 Region: 536-769
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-40
Family YWTD domain 0.0000105
Further Details:      
 
Domain Number 6 Region: 200-469
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-39
Family YWTD domain 0.0000794
Further Details:      
 
Domain Number 7 Region: 1892-2147
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-29
Family YWTD domain 0.0000696
Further Details:      
 
Domain Number 8 Region: 2196-2434
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-26
Family YWTD domain 0.00022
Further Details:      
 
Domain Number 9 Region: 1182-1261,2472-2522
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000698
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 10 Region: 848-890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 11 Region: 929-968
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 12 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 13 Region: 1013-1050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 14 Region: 2691-2728
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 889-931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 16 Region: 974-1011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 17 Region: 1057-1097
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 18 Region: 2558-2598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 19 Region: 2731-2765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 2813-2849
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 21 Region: 2598-2637
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 22 Region: 2851-2890
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 23 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000152
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 24 Region: 2771-2805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 25 Region: 2903-2938
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 26 Region: 3494-3530
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 27 Region: 2522-2559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 2980-3021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 29 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 30 Region: 1846-1896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000189
Family EGF-type module 0.012
Further Details:      
 
Domain Number 31 Region: 802-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000024
Family EGF-type module 0.041
Further Details:      
 
Domain Number 32 Region: 1105-1140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 2948-2986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000301
Family EGF-type module 0.021
Further Details:      
 
Domain Number 34 Region: 1143-1178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 35 Region: 2657-2687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000118
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 36 Region: 3539-3585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.052
Further Details:      
 
Domain Number 37 Region: 2150-2197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000119
Family EGF-type module 0.012
Further Details:      
 
Domain Number 38 Region: 1545-1596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000652
Family EGF-type module 0.024
Further Details:      
 
Domain Number 39 Region: 3951-3986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000678
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000028683
Domain Number - Region: 3578-3614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000172
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 486-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000637
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 3988-4026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 3345-3371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00223
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number - Region: 4023-4059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00314
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 4130-4168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00559
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 3907-3940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4062-4095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0954
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000028683
Sequence length 4298
Comment (Macaca mulatta)
Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELRGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADSKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDNAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRT
VSCACPHLMKLHKDKTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLW
WADQVSEKMGTCSKADGSGSIVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQL
CLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGEQW
VGLWGLRCGRGLGDVGGGGVGGSRKRSCRGHQVHLYLFWTEWGQYPRIERSRLDGTERVV
LVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSVSVFE
DFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGG
CQQLCLYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNLNAPVQ
PFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVENVGSV
EGLAYHRGWDNLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQNL
MFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCE
YDGSHRYVRRWQDASSGPHSVAVRGQARLWSSGDWARGPSDAVTQRLGSSVKSHSGCMHN
REHSAALRPPCPCSGELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAVNS
SCRAQDEFECANGECINFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVSNM
LWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSAT
DCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFA
CPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDG
SDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDDRE
FMCQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDGEN
DCHDQSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEVLLCNGQDDCGDGSDERGCHIN
ECLSHKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTHGS
YKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVAL
DFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKG
RDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSRSV
IVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFED
YVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDGEQARGGSSWELGS
LGVPAYPFSSTDQALSWPDTGRLQEGLDGGWFGSRELQPSLDPNDRVCLWIGRQCDGMDN
CGDGTDEEDCGEQGADKGLQGADSAQWGECEPCGSCIGVRINQEDWPRKGRLLGVWRLFQ
EKPPGEGSGGCLMHRSWRWGWEPESLTCPHCKPCQRNWEPPVSMGSLWEEGAGVNTQGLK
PPPSSEPPTAQTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDPKLTSCA
TNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHL
CSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMD
VHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAID
WVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKI
ETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSK
RGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYHQHKQPE
VTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTCNLQCFN
GGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPK
CTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSR
QCRCTAYFEGLRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCIGHCSNGGS
CTMNSKMMPECQCPPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLVLLVAGVVFWYKR
RVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPV
YATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences ENSMMUP00000028682 9544.ENSMMUP00000028683 ENSMMUP00000028683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]