SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000033410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000033410
Domain Number 1 Region: 5-50
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000893
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000033410
Sequence length 115
Comment (Macaca mulatta)
Sequence
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKNN
LFEAFMALAVLITLIIGAFYFLCRKGHFQRASSVQYDVSLVETSSTSAHHSHGEH
Download sequence
Identical sequences A0A2K5TJ77
9544.ENSMMUP00000033410 ENSMMUP00000027477 XP_001104381.1.72884 ENSMMUP00000033410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]