SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000040036 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000040036
Domain Number 1 Region: 867-998
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-19
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 614-727
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000416
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000040036
Sequence length 1181
Comment (Macaca mulatta)
Sequence
WLEYFRSLFFSAPDDLPEIILTLSLISTIGAFLNLHLKDFPIPLPVMLFLLGCGFEVLSF
TSLRVQRYANAIQWMSPDLLFCIFAPVIFFTTAFDMDTYMLQKLFWQILLITIPGFLVNY
ILVLWYLAAVNKLHLKPTPWLLFSAILVSSDPMLTAAAVRDLGLSRSLISLINGESLMTS
VISLIIFTSIMDFDKEQQNKRNHTIARYIVGEFFSNIIASFLFGILSSKLIQFWMSTVFG
DDVNHISLIFSILYLIFYICNELLGMSGIFTLAIVGLLLNSTSFKAGVEALLLEFWNFLS
RVAFLMVFTFFGLLIPAHTYLYVKFADIYYSLNIYFTLIVLRLVTLLLMSPALSRVGHEF
SWRWVFTMIWSETKGMPNINMALLLAYSDLYFGSDKEKSQILFHGVLVCLITLIVNRFVL
PTAVTILGLRDATSTKYKSVCCTFQHFQELTKSVASVLKFDKDLANADWNMIEKAIILEN
PYMLNQEETTEQQKVKCPHCNKEIDEILNNEAMELANRRLLSAQMASYQRQYRNEILSQS
AVQVLVGAAGSFGEKKGKCMRLETIKNYSESQKTITFTRKLLLNWVYNTRKEKVGPSKYF
FFHLCHTIVFTEEFEYVGYLVILMNIFPFVISWISRLNAIYRRELKHTNYCFLTLYVLEA
LLKIAAMRKDFFSHTWNLFELAITLTGILYAILTEIEAIKYIFAVTEIIVFIKLVQFIRI
LRIFKLIAPKVLQIIDKRVSQQKTFWYGILKGYVQGEADVMTIIDQITSSKQIKQILLKR
VIRNMKHATKELGYLEYDHPEIAVTVKTKEEINVMLNMAREILKAFGLKGIIHKIESAQI
SKLIMAKKKEMLESKSIIRPLTVEEVLYHIQWLDKNQDHINFIQEKAKVVTFDCGNGIFE
EGDEPQGIYIIISGMVKLERSKPGLGIDQMVESKEKDFLIIDTDYMLSGEIIGEINCLTN
EPMKYSATCETVVETCFIPKTHLYDAFKQCSPLIEHKMWLKIGLAITARKIREHLSYEDW
NYKMQLKLSNIYIEDIPMTTKTDIYDENVIYVILIHGAVEDCQLRKFYRAPFLIPITCHQ
IQGIEDFTKVVIIQTPTNMKAFRWNIRKFIPKHKSSLTPGLMPGSTETLEAGIQGETKTN
VKEDGAHSTATARSPQPCSLLLTKFNCKKSLRINLGKSGKP
Download sequence
Identical sequences ENSMMUP00000040036 9544.ENSMMUP00000040036 ENSMMUP00000021147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]