SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000013953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000013953
Domain Number 1 Region: 821-1017
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.86e-47
Family cAMP-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 609-812
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.79e-22
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000013953
Sequence length 1183
Comment (Pan troglodytes)
Sequence
MLGWVQRVLPQPPGTPRKTKMQEEEKVEPEPETEAEVESEPNPEEAETESESMPPEESFK
EEEVAVADPSPQETKEAALTSTISLRAQGAEISEMNSNEALEAQDTRPGLRLLLWLEQNL
DRVLPQPPKSSEVWRDEPAVATGAASDPXPPGRPQEMGPKLQARETPSLPTPIPLQPKEE
PKEAPAPEPQPGSQVQTSSLPPPRDPARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGI
CDVQTISILPGGQVEPDLVLEEVEPPWEDAHQDISTSPQGTEVVPAYEEENKAVEKMPRE
LSRIEEEKEDEEEEEEEEEEEEEEEVTEVLLDSCAVSQVGVGQSEEDGTRPQSASDQKLW
EEVGEEAKEEAEEKAKEEAEEAAEEEAEKEPQDWAETKEEPEAEAEAASSGVPATKQHPE
VQVEDTDADSCPLMAEENPPSTVLPPPSPAKSDTLIVPSSASGTHRKKLPSEDDEAEELK
ALSPAESPVVAWSDPTTPKDTDGQDRAASMASTNSAIINDRLQELVKLFKERTEKVKEKL
IDPDVTSDEESPKPSPAKKAPEPAPDTKPAEAKPVEEEHYCDMLCCKFKRRPWKKYQFPQ
SIDPLTNLMYVLWLFFVVMAWNWNCWLIPVRWAFPYQTPDNIHLWLLMDYLCDLIYFLDI
TVFQTRLQFVRGGDIITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRC
LKVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAVKTLITIGG
LPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYK
IPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQGCDR
QMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVF
GEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRNNN
KPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGRLAHLRARLKELAVLEAAAKQ
QELVEQAKSSQDVKGEEGSAAPDQHTPPKEAATDPPAPRTPPEPPGSPPSSPPPASLGRP
EGEEVGPAEPEEHSVRICMSPGPEPGEQILSVEMPEEREEKAE
Download sequence
Identical sequences 9598.ENSPTRP00000013953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]