SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000018764 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000018764
Domain Number 1 Region: 795-970
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.59e-48
Family Chaperone J-domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 120-276
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.09e-27
Family Dual specificity phosphatase-like 0.00028
Further Details:      
 
Domain Number 3 Region: 284-421
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-26
Family PLC-like (P variant) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000018764
Sequence length 970
Comment (Pan troglodytes)
Sequence
MSLLGSYRKKTSNDGYESLQLVDSNGDLSAGSGGVGGKQRVNAGAAARSPARQPPDRAST
MDSSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGD
LDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHS
RVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCN
LYSTPGPAIRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPIPF
FNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSMYHL
RSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDV
ELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLALGGQAPIDIPPDNPRHYGQS
GFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNTNSDKPHGVKKPSK
KQQEPAAPPPPEDVDLLGLEGSAVSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSG
VEDVFHPSGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTS
SASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGMGSKSAATSPTGSS
HGTPTHQNKPQTLDPFADLGTLGSSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQ
QGGAYNWQQPQPKPQPSMPHSSPQNRPNYNVSFSAMPGGQNERGKGSSNLEGKQKAADFE
DLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTV
LWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSE
FENQGQKPLY
Download sequence
Identical sequences H2PZ68
XP_001161657.1.37143 ENSPTRP00000001430 9598.ENSPTRP00000018764 ENSPTRP00000001430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]