SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000026022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000026022
Domain Number 1 Region: 827-1120
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000206
Further Details:      
 
Domain Number 2 Region: 59-319
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-79
Family Carbonic anhydrase 0.00000745
Further Details:      
 
Domain Number 3 Region: 1124-1410
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.24e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 347-441
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000722
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000026022
Sequence length 1445
Comment (Pan troglodytes)
Sequence
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKLEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQRLHDRVVSKSAVRDAWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
AASASKQAARPVLATTEALASPGPDGDSSPTKDSEGTEEGEKDEKSESEDGEREHEEDGE
KDSEKKEKSGVTHAAEQQNQTEPSPTPSSPNRTAEGGHQTIPGHEQDHTAVPTDQTGGRR
DAGPGLDPNMVTSTQVPPTATEEQYAGSDPKRPEMPSKKPMSRGDRFSEDSRFITVNPAE
KNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREV
PSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKD
SKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK
CDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQ
YHYTQWPDMGVPEYALPVLTFVRRSSAARMPEMGPVLVHCSAGVGRTGTYIVIDSMLQQI
KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSIL
IPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGM
KGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWP
NPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVF
QVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAES
MESLV
Download sequence
Identical sequences H2QMV4
9598.ENSPTRP00000026022 ENSPTRP00000026022 ENSPTRP00000026022 XP_516564.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]