SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000027051 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000027051
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 8.11e-20
Family Ribosomal protein L39e 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000027051
Sequence length 51
Comment (Pan troglodytes)
Sequence
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRSNSKRRHWRRTKLGL
Download sequence
Identical sequences H2R084
ENSPTRP00000027051 9598.ENSPTRP00000027051 XP_003950300.1.37143 XP_008954121.1.60992 ENSPTRP00000027051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]