SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000030417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000030417
Domain Number 1 Region: 332-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-67
Family SPRY domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 159-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000012
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 
Weak hits

Sequence:  9598.ENSPTRP00000030417
Domain Number - Region: 258-303
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0518
Family YkuI C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000030417
Sequence length 513
Comment (Pan troglodytes)
Sequence
MKMASFVAFLLLIFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYEDGGIHLECRSTGWYPQPQIQWS
NNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADP
FFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQ
EQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQR
SVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG
WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPTKVGVFLDYETGDISFYNAVDGS
HIHTFLDVSFSEALYPVFRILTLEPTALTICPA
Download sequence
Identical sequences H2QSH4
9598.ENSPTRP00000030417 ENSPTRP00000030417 XP_009448928.1.37143 XP_016810530.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]