SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000049442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000049442
Domain Number 1 Region: 252-323
Classification Level Classification E-value
Superfamily TAFH domain-like 7.32e-28
Family TAFH domain-like 0.0000811
Further Details:      
 
Domain Number 2 Region: 548-595
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000452
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000049442
Sequence length 756
Comment (Pan troglodytes)
Sequence
MPAGLTEPAGAAPPAAVSASGTVTMAPAGALPVRVESTPVALGAVTKAPVSVCVEPTASQ
PLRSPVGTLVTKVAPVSAPPKLSSGPRLPAPQIVAVKAPNTTTIQFPANLQLPPGTVLIK
SNSGPLMLVSPQQTVTRAETTSNITSRPAVPANPQTVKICTVPNSSSQLIKKVAVTVKKL
AQIGTTVVTTVPKPSSVQSVAVPTSVVTVTPGKPLNTVTTLKPSSLGASSTPSNEPNLKA
ENSAAVQINLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEAE
EFTRKLYVELKSSPQPHLVPFLKLLHTTKPLVTSVPNTVTTVSLQPEKPVVSGTAVTLSL
PAVTFGETSGAAICLPSVKPVVSSAGTTSDKPVIGTPVQIKLAQPGPVLSQPAGIPQAVQ
VKQLVVQQPSGGNEKQVTTISHSSTLTIQKCGQKTMPVNTIIPTSQFPPASILKQITLPG
NKILSLQASPTQKNRIKENGTSCFRDEDDINDVTSMAGVNLNEENACILATNSELVGTLI
QSCKDEPFLFIGALQKRILDIGKKHDITELNSDAVNLISQATQERLRGLLEKLTAIAQHR
MTTYKASENYILCSDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRL
KQKAKELQQLELAQIQHRDANLTALAAIGPRKKRPLESGIEGLKDNLLASGTSSLTATKQ
LHRPRITRICLRDLIFCMEQEREMKYSRALYLALLK
Download sequence
Identical sequences ENSPTRP00000049442 9598.ENSPTRP00000049442 ENSPTRP00000049442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]