SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9598.ENSPTRP00000057687 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9598.ENSPTRP00000057687
Domain Number 1 Region: 824-957
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.13e-20
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 573-687
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000141
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9598.ENSPTRP00000057687
Sequence length 1137
Comment (Pan troglodytes)
Sequence
MAAIFKEFFFSTEDLPEVILTLSLISSIGAFLNRHLEDFPIPVPVILFLLGCSFEVLSFT
SSQVQRYANAIQWMSPDLFFRIFTPVVFFTTAFDMDTYMLQKLFWQILLITIPGFLINYI
LVLWHLASVNQLLLKPTQRLLFSAILVSSDPMLTAAAIRDLGLSRSLISLINGESLMTSV
ISLITFTSIMDFDQRLQSKRNHTLAEEIVGGICSYIIASFLFGILSSKLIQFWMSTVFGD
DVNHISLIFSILYLIFYICELVGMSGIFTLAIVGLLLNSTSFKAAIEETLLLEFWTFLSR
IAFLMVFTFFGLLIPAHTYLYIEFVDIYHSLNIYFTLIVLRFLTLLLMSPVLSRVGHEFS
WRWVFIMVCSEMKGMPNINMALLLAYSDLYFGSDKEKSQILFHGVLVCLITLVVNRFILP
VAVTILGLRDATSTKYKSVCCTFQHFQELTKSAASALKFDKDLANADWNMIEKAITLENP
YMLNEEETTEHQKVKCPHCNKEIDEIFNTEAMELANRRLLSAQIASYQRQYRNEILSQSA
VQVLVGAAESFGEKKGKYFFFRICHTIVFTEEFEHVGYLVILMNIFPFIISWISQLNVIY
HSELKHTNYCFLTLYILEALLKIAAMRKDFFSHAWNIFELAITLIGILHVILIEIDTIKY
IFNETEVIVFIKVVQFIRILRIFKLIAPKLLQIIDKRMSHQKTFWYGILKGYVQGEADIM
TIIDQITSSKQIKQMLLKQVIRNMEHAIKELGYLEYDHPEIAVTVKTKEEINVMLNMATE
ILKAFSLKGIISKTEGAGINKLIMAKKKEVLDSQSIIRPLTVEEVLYHIPWLDKNKDYIN
FIQEKAKVVTFDCGNVIFEEGDEPKGIYIIISGMVKLEKSKPGLGIEQMVESKEKDFPII
DTDYMLSGEIIGEINCLTNEPMKYSATCKTVVETYFIPKTHLYDAFEQCSPLIKHKMWLK
IGLAITARKIREHLSYEDCNYKMQLKLSNIYVVDIPMSTKTDIYDENLIYVILIHGAVED
CLLRKTYRAPFLIPITCHQIQSIEDFTKVVVIQTPINMKTFRRNIRKFVPKHKSSLTPGL
IGSAGTLEEGIQEETNVKEDGAHSAATARSPQPCSLLGTKFNCKESPRINLRKVRKE
Download sequence
Identical sequences ENSPTRP00000057687 ENSPTRP00000057687 9598.ENSPTRP00000057687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]