SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000002867 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000002867
Domain Number 1 Region: 21-229
Classification Level Classification E-value
Superfamily PHP domain-like 1.22e-45
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000002867
Sequence length 267
Comment (Pongo pygmaeus)
Sequence
MAVFADLDLRAGSDLKVLRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTT
LPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGLAFELVYSPAIKDSTMRRYTISNALNLMQIC
KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG
IISTVKKPRPSEDEDCLPASKKAKCEG
Download sequence
Identical sequences H2NAZ6
XP_009243892.1.23681 9600.ENSPPYP00000002867 ENSPPYP00000002866 ENSPPYP00000002866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]