SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000006976 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000006976
Domain Number 1 Region: 193-705
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.69e-49
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 2 Region: 662-810
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000863
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000006976
Sequence length 811
Comment (Pongo pygmaeus)
Sequence
DSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTK
ARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKETAVPATKRLNRSVSLLNACKLNR
STPSNIKRTSSSERVSPGGRRESNGDSRGNRNRTGSTSSSSSGKKNSESKPKEPVFSAEE
GYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTG
ETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPH
VRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEEKL
ADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVLCV
TFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKL
ISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTD
ELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVGTL
TGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKYMR
VGKCSGHSSFITHLDWSINSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYTCT
LGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHS
SHVTNVDFLCEDSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences H2NM87
9600.ENSPPYP00000006976 ENSPPYP00000006976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]