SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000007050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000007050
Domain Number 1 Region: 26-64
Classification Level Classification E-value
Superfamily POZ domain 0.000029
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000007050
Sequence length 369
Comment (Pongo pygmaeus)
Sequence
MDFSPWPSPAMGAWEPAPDAGPASPRYMYSDEIDLEADTVLATLYAAKKYIVPALAKACV
NFLETSLEAKNACVLLSQSRLFEEPELTQRCWEVIDAQAEMALRSEGFCEIDRQTLEIIV
TREALNTKEAVVFEAVLNWAEAECKRQGLPVTPRNKRHVLGRALYLVRIPTMTLEEFANG
AAQSDILTLEETHSIFLWYTATNKPRLDFPLTKRKGLAPQRCHRFQSSAYRSNQWRYRGR
CDSIQFAVDRRVFIAGLGLYGSSSGKAEYSVKIELKRLGVVLAQNLTKFMSDGSSNTFPV
WFEHPVQVEQDTFYTASAVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGG
QIPELIFYA
Download sequence
Identical sequences H2NMF9
ENSPPYP00000007050 9600.ENSPPYP00000007050 ENSPPYP00000007050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]