SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000010418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000010418
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-34
Family Voltage-gated potassium channels 0.0067
Further Details:      
 
Domain Number 2 Region: 259-368
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.99e-19
Family cAMP-binding domain 0.00000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000010418
Sequence length 466
Comment (Pongo pygmaeus)
Sequence
FYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIED
NTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVRFTKI
LSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPML
QDFPRNCWVSINGMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVG
ATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGK
MFDEDSILGELNGPLREICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAF
ETVAIDRLDRISPYGGLPAAPLAGPAKRRLSRASRPLSASQPSLPHGAPGPAASTRPASS
STPRLGPTPAARAAAPSPDRRDSASSGAAGGLDPQDSAHSRLSSNL
Download sequence
Identical sequences H2NWQ3
ENSPPYP00000010418 ENSPPYP00000010418 9600.ENSPPYP00000010418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]