SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000010432 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000010432
Domain Number 1 Region: 16-252
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.28e-74
Family Eukaryotic proteases 0.00000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000010432
Sequence length 253
Comment (Pongo pygmaeus)
Sequence
MHSWERLAVLVLLGAAACAAQPRGRILGGREAEAHARPYMASVQVNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSRPDTIDHDLLLIQL
SEKATLGPAVRPLPWQRVDHDVAPGTLCDVAGWGIVNHAGRRPDRLQHVLLPVLDRATCN
RRTHHDGAITERMMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWLDSVLA
Download sequence
Identical sequences H2NWR7
ENSPPYP00000010432 ENSPPYP00000010432 9600.ENSPPYP00000010432 XP_003779057.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]