SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000014692 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000014692
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-27
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 2 Region: 1905-2072
Classification Level Classification E-value
Superfamily Fibronectin type III 3.13e-27
Family Fibronectin type III 0.00000936
Further Details:      
 
Domain Number 3 Region: 909-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-25
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 4 Region: 1634-1799
Classification Level Classification E-value
Superfamily Fibronectin type III 6.91e-24
Family Fibronectin type III 0.0000113
Further Details:      
 
Domain Number 5 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 3.79e-23
Family Fibronectin type III 0.000007
Further Details:      
 
Domain Number 6 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 7 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.46e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 8 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-20
Family Fibronectin type II module 0.0000518
Further Details:      
 
Domain Number 9 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 3.5e-17
Family Fibronectin type III 0.00000264
Further Details:      
 
Domain Number 10 Region: 1811-1900
Classification Level Classification E-value
Superfamily Fibronectin type III 5.94e-17
Family Fibronectin type III 0.00000426
Further Details:      
 
Domain Number 11 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000085
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 12 Region: 2308-2351
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000361
Family Fibronectin type III 0.00000305
Further Details:      
 
Domain Number 15 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000116
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 16 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 18 Region: 2263-2306
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000506
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 19 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 20 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2351-2392
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 2165-2241
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000193
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 24 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000353
Family Fibronectin type I module 0.00035
Further Details:      
 
Domain Number 25 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000187
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000014692
Sequence length 2445
Comment (Pongo pygmaeus)
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTAASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDAEQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPFSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
IFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHLSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALDTLTSRPAQGVVTTLENVSPPRRARVTDATETTI
TISWRTKTETITGFQVDAVPSNGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNA
RSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSSPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI
LDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIR
HRPRPYPPNVGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTG
LTRGATYNIIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEW
ERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGN
GKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPS
PEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences H2P8I4
ENSPPYP00000014692 9600.ENSPPYP00000014692 ENSPPYP00000014692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]