SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000015153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000015153
Domain Number 1 Region: 862-995
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-20
Family cAMP-binding domain 0.011
Further Details:      
 
Domain Number 2 Region: 611-725
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000275
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000015153
Sequence length 1166
Comment (Pongo pygmaeus)
Sequence
MAGIFKFFFSTEDLPEVILTLSLISTIGAFLNRHLEDFPIPVPVILFLLGCSFEVLSFTS
SQVHRYANAIQWMSPDLFFRIFTPVIFFTTAFDMDTYMLQKLFWQILVITIPGFLVNYIL
VLWHLASVNKLLLKPTPWLLFSAILVSSDPMLTAAAIRDLGLSRSLISLINGESLMTSVI
SLITFTSIMDFDKRLQSKRNHTLAEEIVYGICSHIIASFLFGILSSKLIQFWMSTVFGDD
VNHISLIFSILYLIFYICELVGMSGIFTLAIVGLLLNSTSFKAAIEETLLLEFWTFLSRI
AFLMVFTFFGLLIPAHTYLYIKFVDIYYSLNIYFTLIVLRFVTLLLMSPVLSRVGHEFSW
RWIFIMVCSETKGMPNINMALLLAYSDLHFGSDKEKSQILFHGVLVCLITLVVNRFILPM
AVTILGLRDATSTKYKSVCCTFQHFQELTKSAASALKFDKDLANADWNMIEKAIILENPY
MLNEEETEHQKVKCPHCNKEIDEIFNTEAMELANRRLLSAQIASYQRQYRNEILSQSAVQ
VLVGAAESFGEKKGKCMSLDTIKNYSESQKTITFARKLLLNWVYNTRKEKEGPSKYFFFH
ICHTIVFTEEFEHVGYLVILMNIFPFIISWISQLNVIYHSELKHTNYCFLTLYILEALLK
IAAMRKDFFSHAWNIFELAITLIGILHAILFEIDTIKYIFNETEVIVFIKVVQFIRILRI
FKLIAPKLLQIIDKRMSHQKTFWYGILKGYVQGEADIMTIIDQITSSKQIKQMLLKQVIR
NMEHAMKELGYLEYDHPEIAVTVKTKEEINVMLNMATEILKAFRLKGIISKTEGAGINKL
IMAKKKEVLDSQFIIRPLTVEEVLYHIPWLDKNKDHINFIQEKAKVVTFDCGNDIFEEGD
EPKGIYIIISGMVKLEKSKPGLGIDQMVESKEKEFPIIDTDYMLSGEIIGEINCLTNEPM
KYSATCKTVVETCFIPKTHLHDAFEQCSPLIEHKMWLKIGLAITARKIREHLSYEDWNYK
MQLKLSNIYVVDIPMSTKTDIYDENLIYVILIHGAVEDCLLRKTYRAPFLIPITCHQEDF
TKVVVIQPINKFRRNRKFVPKHKSYLTPGLIGSAGTSEEGIQEETNVKEDGAHSAATSRS
PQPCSLLTKFNSKESPRINLRKVRKE
Download sequence
Identical sequences H2P9R2
ENSPPYP00000015151 ENSPPYP00000015151 9600.ENSPPYP00000015153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]