SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000015950 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000015950
Domain Number 1 Region: 281-458,493-659
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.91e-82
Family YicI catalytic domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 1155-1347,1392-1553
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.5e-73
Family YicI catalytic domain-like 0.00024
Further Details:      
 
Domain Number 3 Region: 904-1151
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.1e-45
Family YicI N-terminal domain-like 0.0084
Further Details:      
 
Domain Number 4 Region: 88-280
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.1e-34
Family YicI N-terminal domain-like 0.006
Further Details:      
 
Domain Number 5 Region: 1556-1636
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.3e-17
Family Putative glucosidase YicI, domain 3 0.024
Further Details:      
 
Domain Number 6 Region: 662-742
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000403
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 7 Region: 876-928
Classification Level Classification E-value
Superfamily Trefoil 0.0000000225
Family Trefoil 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000015950
Sequence length 1776
Comment (Pongo pygmaeus)
Sequence
MARKKFSGLEISLIVLFVIVTIIAIALIVVLATKTPAVDEISDSTSTPATTRVTTNPSDF
GKCPNALNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDTT
TTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKFDTSIGPLVYSDQYLQIST
RLPSDYIYGIGEQVHKRFRHDLSWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKS
FGVFLMNSNAMEIFIQPTPIVTYRVTGGILDFYIFLGDTPEQVVQQYQQLVGLPAMPAYW
SLGFQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQF
VQDLHDHGQKYVIILDPAISIGRRASGTTYATYERGNTQHVWINESDGSTPIIGEVWPGL
TVYPDFTNPNCIDWWANECSIFHQEVPYDGLWIDMNEVSSFIQGSTKGCNVNKLNYPPFT
PDILDKLMYSKTICMDAVQNWGKQYDVHSLYGYSMAIATEQAVQKVFPNKRSFILTRSTF
AGSGRHAAHWLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELCRRWMQ
LGAFYPFSRNHNSDGYEHQDPAFFGQNSLLVKSSRHYLTIRYTLLPFLYTLFYKAHVFGE
TVARPVLHEFYEDTNSWIEDTEFLWGPALLITPVLKQGADTVSAYIPDAIWYDYESGAKR
PWRKQRVDMYLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALGENNTAKGDFF
WDDGETKYTIQNGSYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTDTVTEVR
VAENNQPMSAHSNFTYDASNQVLLIADLNLNLGRSFSVQWNQIFSENEMFNCYPDADLAT
EQTCRQRGCVWRTGSSLSKAPECYFPRQDNSYSVNSARYSSMGITADLQLNTANARIKLP
SDPISTLRVEVKYHKNDMLQFKIYDPQKKRYEVPVPLNIPTTPISTYEDRLYDVEIKENP
FGIQIRRRSSGRVIWDSWLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWNTW
GMFTRDQPPGYKLNSYGFHPYYMALEEEGNAHGVFLLNSNAMDVTFQPTPALTYRTVGGI
LDFYMFLGPTPEVATKQYHEVIGHPVMPAYWALGFQLCRYGYANTSEVQELYDAMVAANI
PYDVQYTDIDYMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETKTYPAF
ERGQQNDVFVKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHVAFPDFFRTSTA
EWWTREILDFYNEKMKFDGLWIDMNEPSSFVNGTTTNQCRNEKLNYPPYFPELTKRTDGL
HFRTICMEAEQILSDGTSVLHYDVHNLYGWSQMKPTHDALQKTTGKRGIVISRSTYPTSG
RWGGHWLGDNYARWDNMDKSIIGMMEFSLFGISYTGADICGFFNNSEYHLCTRWMQLGAF
YPYSRNHNIANTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHALGGTVIRPL
LHEFFDEKPTWDIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDIGVRGQF
QTFDAPYETINLHVRGGHILPCQEPARNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGES
IDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSIHVWGKGATPVNAVTLTYNG
NKNSLPFNEDSTKTILNIDLTTHNVTLEEPIEINWS
Download sequence
Identical sequences H2PBX2
9600.ENSPPYP00000015950 ENSPPYP00000015950 ENSPPYP00000015950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]