SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000018675 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000018675
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4e-166
Family Phosphoglycerate kinase 0.00000000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000018675
Sequence length 417
Comment (Pongo pygmaeus)
Sequence
MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVL
MSHLGRPDGVPMPDKYSLAPVAVELKSLLGKDVLFLKDCVGTEVEKACANPAPGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGK
ATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
KATSKGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNV
Download sequence
Identical sequences H2PJB3
ENSPPYP00000018675 XP_002817023.1.23681 ENSPPYP00000018675 9600.ENSPPYP00000018675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]