SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9600.ENSPPYP00000020383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9600.ENSPPYP00000020383
Domain Number 1 Region: 457-642
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.81e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 312-364,393-493
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.01e-31
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9600.ENSPPYP00000020383
Sequence length 947
Comment (Pongo pygmaeus)
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQRSCFLCLVDVVRAKTFRLKLPALLALTARESSVRS
GGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSPPPSAP
GPLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPPRHAST
GAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAPKIKE
RTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFT
PYSAAFLLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIG
NMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSP
NTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNP
LRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLR
ALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLY
ARPGKSNGDVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSP
GSAELEGGFSRQRKRKLSFRRRTDKDTEQPGEVSALGPGRAGAGPSSRGRPGGPWGESPS
SGPSSPESSEDEGPGRSSSPLRLVPFSSPRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFS
GVSNIFSFWGDSRDRQYQELPRCPAPTPSLLNIPLSSPGRRPRGDVESRLDALQRQLNRL
ETRLSADMATVLQLLQRQMTLVPPAYSAVTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVS
QFMACEELPPGAPELPQDGPMRRLSLPGQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences H2PP15
ENSPPYP00000020383 9600.ENSPPYP00000020383 ENSPPYP00000020383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]