SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000320828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000320828
Domain Number 1 Region: 47-174
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-50
Family Phosphotyrosine-binding domain (PTB) 0.0000767
Further Details:      
 
Domain Number 2 Region: 494-571
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000147
Family SH3-domain 0.00025
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000320828
Domain Number - Region: 630-689
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00033
Family SAM (sterile alpha motif) domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000320828
Sequence length 715
Comment (Homo sapiens)
Sequence
MSQSGAVSCCPGATNGSLGRSDGVAKMSPKDLFEQRKKYSNSNVIMHETSQYHVQHLATF
IMDKSEAITSVDDAIRKLVQLSSKEKIWTQEMLLQVNDQSLRLLDIESQEELEDFPLPTV
QRSQTVLNQLRYPSVLLLVCQDSEQSKPDVHFFHCDEVEAELVHEDIESALADCRLGKKM
RPQTLKGHQEKIRQRQSILPPPQGPAPIPFQHRGGDSPEAKNRVGPQVPLSEPGFRRRES
QEEPRAVLAQKIEKETQILNCALDDIEWFVARLQKAAEAFKQLNQRKKGKKKGKKAPAEG
VLTLRARPPSEGEFIDCFQKIKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIVNTCSG
PDIARSVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFH
SGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSRQSIRNSQKHSPTSEPTPPGDALPPVSS
PHTHRGYQPTPAMAKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRSRSGQAGY
VPCNILGEARPEDAGAPFEQAGQKYWGPASPTHKLPPSFPGNKDELMQHMDEVNDELIRK
ISNIRAQPQRHFRVERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFS
LNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGEDS
Download sequence
Identical sequences Q9H6S3
gi|21264616|ref|NP_073609.2| NP_073609.2.87134 NP_073609.2.92137 XP_016873619.1.92137 XP_016873620.1.92137 XP_016873621.1.92137 9606.ENSP00000320828 ENSP00000320828 ENSP00000435585 ENSP00000436035 ENSP00000320828 ENSP00000435585 ENSP00000436035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]