SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000337163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000337163
Domain Number 1 Region: 267-381
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-32
Family Pleckstrin-homology domain (PH domain) 0.00008
Further Details:      
 
Domain Number 2 Region: 524-627
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-25
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily Phenylalanine zipper 5.36e-22
Family Adapter protein APS, dimerisation domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000337163
Sequence length 671
Comment (Homo sapiens)
Sequence
MNGAPSPEDGASPSSPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPS
SAGPLETSSGPPVLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGAL
KDGAGMVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEG
GGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVD
AQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPS
QDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEE
GPPTGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQL
VLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM
LEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPF
GASDCVTDHLP
Download sequence
Identical sequences A0A024QZC2
ENSP00000337163 ENSP00000378903 NP_001139268.1.87134 NP_001139268.1.92137 NP_001139284.1.87134 NP_001139284.1.92137 NP_056318.2.87134 NP_056318.2.92137 gi|224926822|ref|NP_001139284.1| gi|224926824|ref|NP_056318.2| gi|224926828|ref|NP_001139268.1| ENSP00000337163 ENSP00000378903 9606.ENSP00000337163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]