SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000348043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000348043
Domain Number 1 Region: 26-157
Classification Level Classification E-value
Superfamily L domain-like 4.08e-22
Family Internalin LRR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000348043
Sequence length 184
Comment (Homo sapiens)
Sequence
MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANN
ELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP
ALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGAR
APLP
Download sequence
Identical sequences A0A024QZM2 H2R4A0 Q8TCA0
ENSP00000348043 ENSP00000362321 ENSPTRP00000046801 ENSPTRP00000046801 NP_001265140.1.87134 NP_001265140.1.92137 NP_001265141.1.87134 NP_001265141.1.92137 NP_997002.1.87134 NP_997002.1.92137 XP_001171054.1.37143 XP_001171077.1.37143 XP_001171118.1.37143 XP_009456908.1.37143 XP_016871863.1.92137 XP_016871864.1.92137 ENSP00000348043 ENSP00000362321 gi|46397369|ref|NP_997002.1| ENSP00000348043 GO.42651 9598.ENSPTRP00000046801 9606.ENSP00000348043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]