SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000356189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000356189
Domain Number 1 Region: 20-140
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-37
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000356189
Sequence length 438
Comment (Homo sapiens)
Sequence
MTSYMAIDGSALQVPLRQKPRRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLS
NKWKKFWVILKGSSLYWYSNQMAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFY
FAAENVQEMNVWLNKLGSAVIHQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLT
AQQASSSSPSLSGTSYSFSSLENTVKTPSSFPSSLSKERQSLPDTVNSLSAAEDEGQPIT
FAVQVHSPVPSEAGIHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKI
MDKEETKVSEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKI
RTLNSTLKCKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDD
TPQELKKSPSSPSVENSI
Download sequence
Identical sequences NP_001124171.1.87134 NP_001124171.1.92137 NP_001124172.1.87134 NP_001124172.1.92137 XP_005266976.1.92137 XP_005266978.1.92137 XP_016866206.1.92137 gi|194733747|ref|NP_001124171.1| gi|194733753|ref|NP_001124172.1| 9606.ENSP00000356189 ENSP00000356189 ENSP00000394751 ENSP00000356189 ENSP00000394751 ENSP00000356189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]