SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000356379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000356379
Domain Number 1 Region: 766-1068,1108-1162,1206-1261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-69
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 
Domain Number 2 Region: 1705-1791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000194
Family Motor proteins 0.044
Further Details:      
 
Domain Number 3 Region: 2956-3060
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000407
Family Motor proteins 0.044
Further Details:      
 
Domain Number 4 Region: 1524-1613
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000504
Family Motor proteins 0.069
Further Details:      
 
Domain Number 5 Region: 2900-2985
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000138
Family Motor proteins 0.036
Further Details:      
 
Domain Number 6 Region: 1865-1939
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000141
Family Motor proteins 0.038
Further Details:      
 
Domain Number 7 Region: 2017-2082
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000143
Family Motor proteins 0.046
Further Details:      
 
Domain Number 8 Region: 1793-1864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000162
Family Motor proteins 0.026
Further Details:      
 
Domain Number 9 Region: 2668-2736
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000319
Family Motor proteins 0.047
Further Details:      
 
Domain Number 10 Region: 2231-2308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000398
Family Motor proteins 0.027
Further Details:      
 
Domain Number 11 Region: 1258-1375
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000425
Family Motor proteins 0.046
Further Details:      
 
Domain Number 12 Region: 2373-2453
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000451
Family Motor proteins 0.025
Further Details:      
 
Domain Number 13 Region: 1622-1709
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000101
Family Motor proteins 0.038
Further Details:      
 
Domain Number 14 Region: 3109-3232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000252
Family Motor proteins 0.032
Further Details:      
 
Domain Number 15 Region: 1944-2016
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000637
Family Motor proteins 0.042
Further Details:      
 
Domain Number 16 Region: 2522-2597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000425
Family Motor proteins 0.047
Further Details:      
 
Domain Number 17 Region: 2454-2522
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000504
Family Motor proteins 0.051
Further Details:      
 
Domain Number 18 Region: 3257-3354
Classification Level Classification E-value
Superfamily ARM repeat 0.00000595
Family Armadillo repeat 0.049
Further Details:      
 
Domain Number 19 Region: 2086-2157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000069
Family Motor proteins 0.049
Further Details:      
 
Domain Number 20 Region: 1465-1528
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000903
Family Motor proteins 0.042
Further Details:      
 
Weak hits

Sequence:  9606.ENSP00000356379
Domain Number - Region: 2607-2666
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000146
Family Motor proteins 0.02
Further Details:      
 
Domain Number - Region: 2308-2376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000154
Family Motor proteins 0.057
Further Details:      
 
Domain Number - Region: 2149-2223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000425
Family Motor proteins 0.081
Further Details:      
 
Domain Number - Region: 2816-2904
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00138
Family Motor proteins 0.035
Further Details:      
 
Domain Number - Region: 1364-1415
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0558
Family Motor proteins 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000356379
Sequence length 3477
Comment (Homo sapiens)
Sequence
MANRRVGRGCWEVSPTERRPPAGLRGPAAEEEASSPPVLSLSHFCRSPFLCFGDVLLGAS
RTLSLALDNPNEEVAEVKISHFPAADLGFSVSQRCFVLQPKEKIVISVNWTPLKEGRVRE
IMTFLVNDVLKHQAILLGNAEEQKKKKRSLWDTIKKKKISASTSHNRRVSNIQNVNKTFS
VSQKVDRVRSPLQACENLAMNEGGPPTENNSLILEENKIPISPISPAFNECHGATCLPLS
VRRSTTYSSLHASENRELLNVHSANVSKVSFNEKAVTETSFNSVNVNGQRGENSKLSLTP
NCSSTLNITQSQIHFLSPDSFVNNSHGANNELELVTCLSSDMFMKDNSQPVHLESTIAHE
IYQKILSPDSFIKDNYGLNQDLESESVNPILSPNQFLKDNMAYMCTSQQTCKVPLSNENS
QVPQSPEDWRKSEVSPRIPECQGSKSPKAIFEELVEMKSNYYSFIKQNNPKFSAVQDISS
HSHNKQPKRRPILSATVTKRKATCTRENQTEINKPKAKRCLNSAVGEHEKVINNQKEKED
FHSYLPIIDPILSKSKSYKNEVTPSSTTASVARKRKSDGSMEDANVRVAITEHTEVREIK
RIHFSPSEPKTSAVKKTKNVTTPISKRISNREKLNLKKKTDLSIFRTPISKTNKRTKPII
AVAQSSLTFIKPLKTDIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVKT
NISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVK
AIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLED
NSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYA
KISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDE
FDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRG
IELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIK
KTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSD
GRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHE
NTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARL
LDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAAL
VIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSR
IRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQRKMQ
SQVKATVILQRAFREWHLRKQAKEENSAIIIQSWYRMHKELRKYIYIRSCVVIIQKRFRC
FQAQKLYKRRKESILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQI
RAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYI
FAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKN
ATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVR
GYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQ
VKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRA
YKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLF
KTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSY
YRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRI
KDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKI
QSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQR
EKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQ
QRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRR
RFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATF
IQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKT
RRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLYQFLHLRKA
AITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTYRAA
KLQRENYIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWAT
KIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKI
RKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYR
MHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVRQKLKN
VSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVT
IQKAFCRMVTRKLETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFL
LYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQ
AMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNV
RASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQ
KYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLN
AVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQ
RNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKAIRLSLQVVN
REIREENKLYKRTALALHYLLTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIF
VLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNK
VADKGGSIFTKTCCLLAILLKTTNRASDVRSRSKVVDRIYSLYKLTAHKHKMNTERILYK
QKKNSSISIPFIPETPVRTRIVSRLKPDWVLRRDNMEEITNPLQAIQMVMDTLGIPY
Download sequence
Identical sequences Q8IZT6
ENSP00000294732 ENSP00000356379 NP_060606.3.87134 NP_060606.3.92137 9606.ENSP00000356379 HR6294 ENSP00000356379 gi|126116596|ref|NP_060606.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]