SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000357701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000357701
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily EF-hand 1.96e-20
Family S100 proteins 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000357701
Sequence length 101
Comment (Homo sapiens)
Sequence
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMS
VLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Download sequence
Identical sequences G1RHG4 G3RWH4 H2Q033 P33764
ENSPTRP00000002280 cath|current|1ksoA00/2-94 cath|current|1ksoB00/2-94 cath|current|3nsiA00/4-99 cath|current|3nsiB00/3-99 cath|current|3nsoA00/2-99 cath|current|3nsoB00/3-99 ENSP00000357701 gi|4506763|ref|NP_002951.1| ENSPTRP00000002280 ENSP00000357701 ENSP00000357702 ENSP00000357701 ENSP00000357702 ENSGGOP00000020157 ENSNLEP00000012664 9598.ENSPTRP00000002280 9606.ENSP00000357701 1kso_A 1kso_B 3nsi_A 3nsi_B 3nso_A 3nso_B ENSNLEP00000012664 ENSGGOP00000020157 NP_002951.1.87134 NP_002951.1.92137 XP_003259354.1.23891 XP_003259356.1.23891 XP_003259357.1.23891 XP_003339048.1.37143 XP_003817216.1.60992 XP_004026784.1.27298 1ksoA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]