SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000358866 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000358866
Domain Number 1 Region: 31-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1044-1157
Classification Level Classification E-value
Superfamily E set domains 9.34e-37
Family Filamin repeat (rod domain) 0.00000487
Further Details:      
 
Domain Number 3 Region: 1332-1444
Classification Level Classification E-value
Superfamily E set domains 3.67e-36
Family Filamin repeat (rod domain) 0.0000249
Further Details:      
 
Domain Number 4 Region: 1843-1955
Classification Level Classification E-value
Superfamily E set domains 3.89e-36
Family Filamin repeat (rod domain) 0.00000345
Further Details:      
 
Domain Number 5 Region: 1522-1641
Classification Level Classification E-value
Superfamily E set domains 1.53e-34
Family Filamin repeat (rod domain) 0.00000873
Further Details:      
 
Domain Number 6 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 9.34e-33
Family Filamin repeat (rod domain) 0.00038
Further Details:      
 
Domain Number 7 Region: 1435-1542
Classification Level Classification E-value
Superfamily E set domains 2e-32
Family Filamin repeat (rod domain) 0.0000269
Further Details:      
 
Domain Number 8 Region: 1142-1254
Classification Level Classification E-value
Superfamily E set domains 7.34e-31
Family Filamin repeat (rod domain) 0.000075
Further Details:      
 
Domain Number 9 Region: 2036-2138
Classification Level Classification E-value
Superfamily E set domains 8.53e-31
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 10 Region: 671-779
Classification Level Classification E-value
Superfamily E set domains 2.74e-30
Family Filamin repeat (rod domain) 0.00033
Further Details:      
 
Domain Number 11 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 1.15e-29
Family Filamin repeat (rod domain) 0.00041
Further Details:      
 
Domain Number 12 Region: 554-666
Classification Level Classification E-value
Superfamily E set domains 4.54e-29
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 13 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 1.27e-28
Family Filamin repeat (rod domain) 0.0000124
Further Details:      
 
Domain Number 14 Region: 2233-2328
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 15 Region: 380-479
Classification Level Classification E-value
Superfamily E set domains 2.93e-26
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 16 Region: 2427-2519
Classification Level Classification E-value
Superfamily E set domains 5.47e-26
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 17 Region: 1630-1742
Classification Level Classification E-value
Superfamily E set domains 9.14e-26
Family Filamin repeat (rod domain) 0.0000663
Further Details:      
 
Domain Number 18 Region: 279-375
Classification Level Classification E-value
Superfamily E set domains 4.47e-25
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 19 Region: 2555-2646
Classification Level Classification E-value
Superfamily E set domains 5.87e-25
Family Filamin repeat (rod domain) 0.0000177
Further Details:      
 
Domain Number 20 Region: 2334-2425
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0000141
Further Details:      
 
Domain Number 21 Region: 768-870
Classification Level Classification E-value
Superfamily E set domains 2.45e-23
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 22 Region: 2156-2250
Classification Level Classification E-value
Superfamily E set domains 4.4e-21
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 23 Region: 958-1064
Classification Level Classification E-value
Superfamily E set domains 2.8e-20
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 24 Region: 1961-2058
Classification Level Classification E-value
Superfamily E set domains 5.47e-18
Family Filamin repeat (rod domain) 0.0000933
Further Details:      
 
Domain Number 25 Region: 1785-1860
Classification Level Classification E-value
Superfamily E set domains 2.45e-16
Family Filamin repeat (rod domain) 0.0000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000358866
Sequence length 2647
Comment (Homo sapiens)
Sequence
MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
Download sequence
Identical sequences P21333
gi|160420317|ref|NP_001104026.1| 9606.ENSP00000358866 NP_001104026.1.87134 NP_001104026.1.92137 ENSP00000358866 ENSP00000358866 ENSP00000472325 ENSP00000358863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]