SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9606.ENSP00000367197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9606.ENSP00000367197
Domain Number 1 Region: 14-188
Classification Level Classification E-value
Superfamily EF-hand 3.46e-23
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 2 Region: 152-270
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000327
Family Calmodulin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9606.ENSP00000367197
Sequence length 276
Comment (Homo sapiens)
Sequence
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLH
KVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDAD
SSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL
QENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Download sequence
Identical sequences O76038
ENSP00000367197 ENSP00000333933 9606.ENSP00000367197 GO.38466 gi|15055537|ref|NP_008929.2| NP_008929.2.87134 NP_008929.2.92137 ENSP00000367197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]