SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000000701 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000000701
Domain Number 1 Region: 7-102,133-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-65
Family Calponin-homology domain, CH-domain 0.000083
Further Details:      
 
Domain Number 2 Region: 8023-8178
Classification Level Classification E-value
Superfamily Spectrin repeat 2.99e-21
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 8402-8516
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 7803-7927
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-18
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 3300-3422
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-18
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 1589-1723
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-18
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 7395-7526
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-17
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 8 Region: 6940-7084
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-16
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 9 Region: 4476-4631
Classification Level Classification E-value
Superfamily Spectrin repeat 4.48e-16
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 10 Region: 3856-3996
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 11 Region: 7065-7196
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 5029-5172
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000216
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 13 Region: 2426-2555
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000243
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 14 Region: 4256-4412
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000798
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 15 Region: 6729-6869
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000118
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 1369-1504
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000276
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 17 Region: 3728-3849
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000309
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 18 Region: 3084-3208
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000555
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 19 Region: 522-662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000187
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 20 Region: 2644-2770
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000864
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 21 Region: 7593-7744
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000936
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 22 Region: 7316-7429
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000017
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 23 Region: 3534-3666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000173
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 24 Region: 7931-8041
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000448
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 25 Region: 8479-8625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000141
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 26 Region: 2212-2367
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000166
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 27 Region: 5897-6035
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000394
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 28 Region: 2801-2915
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000399
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 5699-5776,5887-5933
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000442
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 30 Region: 1040-1191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000018
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 31 Region: 4925-5023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000202
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 32 Region: 1678-1829
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000662
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 33 Region: 1481-1585
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000993
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 34 Region: 5136-5275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000226
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 35 Region: 3000-3110
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000256
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 36 Region: 5441-5560
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000648
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 3449-3560
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 38 Region: 2016-2154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000192
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 39 Region: 5562-5655
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000824
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 40 Region: 6523-6607
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000226
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 41 Region: 6347-6452
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000419
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 42 Region: 4173-4301
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000694
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 43 Region: 4844-4954
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 44 Region: 852-978
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000157
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 45 Region: 3211-3308
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000245
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 46 Region: 3968-4100
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000288
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 47 Region: 1888-2041
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000046
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 48 Region: 6045-6160
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000849
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 49 Region: 6619-6723
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000849
Family Spectrin repeat 0.0085
Further Details:      
 
Weak hits

Sequence:  9615.ENSCAFP00000000701
Domain Number - Region: 4618-4739
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 5244-5382
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0141
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number - Region: 4085-4189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0366
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000000701
Sequence length 8765
Comment (Canis familiaris)
Sequence
VAKRKPPLVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLE
GRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSGSTSSVDSMVS
AETASPPSKRKVATKIQGNAKKALLKWVQYTVAKLRQTGTEVKDFGRSWRSGVAFHSVIH
AIRPELVDLEKVKGRSNRENLEEAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQF
LKHYPDIHNTGTDGQENDEILPGFPSFANSIQNFKREDRLILKETKVWIEQFERDLTRAQ
MTESNLQDKYQSFKHFRVQYEIKRKQIEHLIQPVHRDGKLSLDQALVKQSWDRVSSRLFD
WHIQLDKSLPAPLGTIGAWLYRAEVALREEITIQQVHEETANTIQRKREQHKDLLQNTDA
HKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVL
AESKLKSWIIKYGRRESVELLLQNYISFIENTKFFEQYEVTYQILKQTAEMYIQADGSVE
EAENVMKFMNETTAQWRNLSVEVRSVRSMLEEVIANWDRYGNTVASLQAWLEDAEKMLNQ
TEHAKKDFFRNLPHWIQQHAAMNDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVK
QYARADELDRMKKEYTDCVNALSDFAMGAHKKLSEPLEVSFLNVKLLIQDLEDIEQRVPV
MDAQYKMITKTAHLITKESSQEEANEMFATMSGLKEQLTKVKDCYSPLLYESQQLLIPLE
ELEKQMTFFYDSVGKINEILTVLEHEAQSSAVFKQKQQELSACQESCKKTMTQIEKGSQN
VQKFMTLSSVLKHFDQTKLHRQIADAHGAFQNMMKKIGDWKKHVETNSRLMKKFEESRAE
LEKVLRIAQEGLEEKGNPEDLLRRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQ
EAVRKLHKQWKDLQGEAPYHLLHLKIDVEKNRFLASVEECRTELDRETKLVPQEGSEKII
KEHRIFFSDKGPHHVCEKRLQLIEELCLKLPGRDPVRNTPETCHVTLKELRAAIDTTYMK
LVEDPDKWKDYTSRISQFSSWISAKETELKGFKNEPIDTANHGKVKHAVEEIRNDVTTKG
ETLNWLKSRLKVLIEVSSENEAQKQGDELAKLSGSFKALVALLSEVEKMLSNFGDCVQYK
EIVKSSLEELISGSKEIQEQAEKILDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIEQ
AQQGEGGLPGQVREELRKLESTLDNMEHSREKQERRIQVTLRKWERFETNKETVVRYLFQ
TGSSHERFLSYSSLESLSSELEQTKEFSKRTEGIAVQAENLVKEASEIPLGPKNKQLLQQ
QAKSIKEQVKKLEDTLEEDIKTMEMVKNKWDHFGNNFETLSIWITEKEKELNALETSSSA
MDMQIHQIKVIIQEIQSKLSSITELEESAQSFAQFVTTGESARIKAKLTQIRRYWEELRE
HAQCLEGTILGHLSQQQKFEENLRKIQKSVSEFEDKLADPVKICSSATETYKVLQEHMDL
CQALEALSSTVATTSASAQKVANRGSCVQEAAALQQRYQEMQSQAKEKQTALEKLLAHWQ
RLEKELSTFLTWLERCEAITSSPEMDISSDRVKVESELQSIQALQNEVVSQASVYSNLLQ
LKESLFSVASKDDVKMMKLHLEQLDERWRDLPQIISKRIAFLQSVVAEHQQFDELLLSLS
VWIKLFLSELQSTSEISITDHQAAFTRHKDHAAEVESKKGELQSLQDHLVKLGALVRAES
LPLLQGKAEDCFQLFEEASQVVERRQLALAQLAEFLQSHVSLSGVLHRLRHTVEATNSMN
RKQTDLLEKDLNHAIQDAKSLESVAISLDSVLAKAQYHLKSGSSEQRTSCRTTADHLCSE
LERIQNLLGIKQSEADALAVLKKAFQDQKEELLKSIEDIEERTDKERLKELTRQALQQSR
LRVFNQLEDELNSHEHELCWLKDKAKQIAQKDVAFASEVDREVNRLEVTWDDTKKLIHEN
QGQCCGLIDLIREYQNLKSAVSKVLENASNVIATRTTIKDQEDLKWALSKHETAKNEMCN
EQKELDFTSKGKQLLFELKKIHSSDFILVKTDMDSTVDRWLDISEKIEENMDRLRVSLTI
WADVLSSKDEIDGWCNSSVPRLAESISNLNNSLRAEEFLKEFESEVKNKALRLEELHCKV
NDLKELTKNPETPPDLQFVEADLRQKLEHAKEITEEAKGTLKDFTAQSTQVEKFINDITS
WLTKVEESLMNCAQTETWEGLKKVKEIQKELQSQQSNISSTQENLNSLCRKYHSVELESL
GSALTGLIKNQEAVSQLCSKTQASLQDSLVKHFNEESMQEFQEWFSGIKTAAKESSDRTG
DSKVLEAKLHNLQQNILDSISDGQSKLDAVTQEGQTLYAHVSKQIVGSIQEKITKANEEF
QAFLKQCLKDKQTLQDCALELGSFEDQHRKLNLWIHEMDERLSTENLGESKQHIPEKKNE
VHKVEMFLGELLAARESLDKLSQRGQLLSEEGHGAGKEGRLCSQLLTNYQNLLRMTKEKL
RSCQVALQEHEALEEALQSMWSWVKAIQDRLAGAESTIGSKDTLEKRLLQIQDILLMKGE
GEVKLNMAIGKGEQALRSSNKQGQKVIQTQLQTLKDVWADIMSSSVHAQSTLESVISKWN
DYLEWRNQLEQWMESVDQKIEHPLQLQPGLKEKFSLLDHFQSIVSEAEDHAGALQHLTSK
SRELYQKTENESFKETAQEELKTQFNDIITVSKEKMRKAEEIVKDHLMYLDAVQEFTDWL
HSAKEELHRWSDMSGDSSATQKKLSKIKELMDSREIGASRLSRVELLAPTVKQNTSASGC
ELVDTEMQALRADWKQWEDSVVQTQTSLENLVSQMALSEQEFSGQVAQLEQALEQFSALL
TTWAQQLALLEGKNTDKEIVECWQKGQEILDALQKAEPKTEDLKSQLNELCRFSRDLSTY
SGKVSSLIKEYNCLCLQASKGCQNREQILQQRFRRAFKDFQQWLVNAKITTAKCFDIPQN
INEVSTNLQKIQEFLSESENGQHKLNMMLSKGELLSTLLTKEKADGIQAKVVTAKEDWKN
FHSNLHQKESALENLKIQMKDFEVSAEPVQDWLSKTEKLVQESSNRLYDLPAKRREQQKL
QSVLEEINCYEPQLNRLREKAQQLWEGQAASKSFMHRVSQLSSQYLALSNLTKEKVSRLD
RIVAEHNQFSLGIKELQDWLTDAVHMLDSYCHPTSDKSVLDSRMLKLEALLSVKQEKEIQ
MKMIVTRGESVLQNTSPEGIPAIQQQLQSVKDMWASLLSAAIRCKSQLEGALSKWTSYQD
DVRQFSGWMDSMEASLNESERQYAELREKTSALGKAKLLSEEVLSYSSLLETIELKGAGM
TEHYVTQLEFQDLQERYRTIKERAKEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQENLD
RHSVLEGDAHTHETTLRDLQELQVRCAEGQALLNSVLHTREEVIPSGIPQTEDRALESLR
QDWQAYQQRLTETRTQFNNVVNKLRLMEQKYQQVDEWLKTLENKVKVRTGRQSNRAAKEI
QLHQMKKWHEEVTAYKDEVEEVGARAQEMLDENHVSSRMGCQATQLTSRYQALLLQVLEQ
IKFLEEEIQSLEESELSLNSYSDWYTSTHKNFKNVATKIDRVDKAMMGKKMKMLEGLLKD
MEKGHSLLKSTREKGERALKYLEDSEAETLRNEIHEHMEQLKELTSTVRKEHMTLEKGLL
LAKEFSDKYKALTQWISEYQEILHTPEEPKMELYEKKAQLSKYKSLQQMVLSHEPSVKSV
REKGEALLELVQDVTLKDEIDKLQSDYKDLCDAGKEHVCSLETKVKDHEDYNSELQEVEK
WLLQMSGRLVAPDLMETSSLETITQQLAHHKAMMEEIAGFEDRLNNLKIKGDNLISQCAD
HLQAKLKQNVHAHLQGTSDSYSAICSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSAVQ
PDLKPSQLPPLSRAEAVKQVKHFRALQEQARTYLDLLCSMCDLSNSSVKTTAKDIQQTEQ
MIEQRLAQAQNLTQGWGEIKHMKAELWIYLQDADQQLQNMKRRHSELELNIAQNMVSQVK
DFVKKLQCKQASVTAITERVNKLTKKQESPEHKEISHLNDQWLDLCLQSNNLCLQREEDL
QRTRDYHDCMNVVEVFLEKFTTEWDNLARSDAESTAVHLEALKKLALALQERKQAIEDLK
DQKQKMIEHLNLDDKELVKEQTSHLEQRWFQLEDLVKRKIQVSVTNLEELNVVRSRFQEL
MEWAEEQQPNISEALKQSPPPDVAQNLLMDHLAICSELEAKQMLLKSLIKDADRVMADLG
LNERQIIQKALSDAQSHVNCLSDLVGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKI
MFREHICLLPDDVSKQVKTCKSAQASLKTYQNEVTGLWAQGRELMKGATEQEKSEILGKL
QELQSVYDTVLQKCSHRLQELEKNLVSRKHFKEDFDKACHWLKQADIVTFPEINLMNESA
ELHTQLAKYQHILEQSPEYENLLLTLQRTGQAILPSLNEVDHSYLNEKLNALPLQFNVVV
ALAKDKFYKVQEAILARKEYASLIELTTQSLSELEDQFLKMNKVPTDLIVEEALSLQDGC
RALLREVSGLGEAVDELNQKKESFRSTGQPWQPDKMLHLVTLYHRLKRQAEQRVNLLEDT
TSAYQEHEKMCHQLEKQLEAVKTEQSKVNEETLPAEEKLKMYHSLAGSLQDSEIILKRVT
VHLEDLVPHLDPLAYEKAKQQIQSWQEELKLLTSAIGATVTECESRMVQSIDFQTELSRS
LDWLRSVKAELSGPVCLELSLQDIQEEIRKIQIHQEEVQSSLRIMNALSNKEKEKFTKAK
ELISADLQHTLAELSELDGDIQEALRTRQAALTQIYSQCQRYYQVFQAANDWLEDAHEML
QLAGNGIDVESAEENLKSHMEFFSTEDQFHRNLEELQGLVASLDPLIKPTGKEDLAQKMA
SLEDKSQRIIQDSHAQLDLLQRCAAQWQDYQKAREEVIELMNDAEKKLSEFSLSKTSSSH
EAEEKLSEHKSLVSVVNSFHEKVVALEDKTSQLEKTGNDASKAAISRSMTTVWQRWTRLR
AVAQDQEKILEDAVDEWKSFNNKVKKATEIIDQLQDKLPGSSAEKASKAELLTLLDFHDT
LILELEQQQLALGLLRQQALSMLQDGATKSPGEEPSIVQEITTMQDRCLNMQEKVKSNGK
VVKQELKEREVVETQINSVKSWVQETKEYLGNPTIEIDAQLEELQILLTEATNRRQNIEK
MTEEQKNKYLGLYSILPSEVSLQLAEVALDLGTIHDQIQDKVREVEQSKAMSQEFSRQIQ
KIAKDLTTILSKLRAKTDNLAQAKSDQKVLGEELDGCNLKLMELDAAVQKFSEQNGQLGK
PLAKKIGKLTELHQQTIRQAENRLSKLSQAASHLEEYNEMLEFILKWIEKAKVLVHGKIT
WNSANQLREQYVLHQTMLEESEEIHSNLEAMIVKLQYLASVYSTEKMSQQVAELGRESEE
LRQMIKIRMHNLQDAAKDMKKFETELKNLQVALEQAQTTLTSPEVGRLSLKEQLSHRQHL
LSEMESLKPKVHAVQICQSALRIPEDVVTSLPLCHAALHLQEEASRLQHTAIQQCNIMQE
AVVQYEQYEQEMQHLRELIEGAHREIEDTPVATSNIQELQAQISRHEELAQKIKGYQEQI
ASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDLDRELLPATSAHPSVVMMTAGRCHT
LLSPVTEESGEEGTNSEISSPPACRSPSPVANADASVNQDIAYYQALSAERLQTDAARIH
PSTLPSQEFYEPGLEPSATAKLDDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSI
STKMEAIEMKLSESLEHGRSPESQMAEHQALMDEILMLQDEISELQSSLAEELVSESPES
DPAEQLALQSTLTVLAERMSTIKMKASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADEL
DHWLLSTKATLDTALGTAKEPMDMEAQLVDCQNMLLEIEQKVVALSELSVHNDNLLLEGK
AHTKEEAEQLAIKLRVLKGSLLELQRALHDKQLNIQGTAQEKEESHVDLTASQSPGVQEW
LAQARTTWTHQRQSSLQQQKQELEQELAEQKSLLRSVASRGEEILTQHSAAETSGGAGEK
PDVLSQELGMEGEKSAAEDQMRMKWESLHQEFSTKQKLLQNVLEQEQEQLLYSRPNRLLS
GVPLYKGDGQTQDKSAVTSLLDGLNQVFEEVSSQSGGKKRQNIHLEQKLYDGVSATSTWL
DDVEERLFVATALLPEETEACLFNQETLAKDIKEMSEEMDKNRNLFSQAFPENGDNRDVI
EDTLGCLLGRLSLLDSVVNQRCHQMKERLQQILNFQNDLKVLCTSLADNKYIILQKLANV
FEQPVAEQIEAIQQAEDGLKELDAGIIELKRRGDKLQIEQPSMQELSKLQDMYDELMMTI
GSRRSGLNQNLALKSQYERALQDLADLLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYF
QGLESHMILTETLFRKIISFAVPQETQFHTELMAQASAVLKRAHKRGVELEYILETWSHL
DEDYQELSRQLEVVESSIPSVGLVEESEDRLIDRIALYQHLKSSLNEYQPKLYQVLDDGK
RLLISISCSDLEGQLNQLGEHWLNNTNKVSKELHRLETVLKHWTRYQSESAELIHWLQSA
KDRLEFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDAKSSLKSSVLSTGNQLLRLKKVDT
AALRSELSHIDSQWTDLLTNIPTVQEKLHQLQMDKLPSRHAISEVMTWISLMENVIQKDE
ENIQNSVGYKAIHEYLQKYKGFKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAE
QLGAMNKSWQILQGLVTEKIQLLEGLLESWSEYENNVQSLKTWYETQENRLKQQHRIGDQ
ASVQNAMKDCQDLEDLVKAKEKEVERIEQSGLALIQNKKEEVSGIVMSTLRELNQTWANL
DHMVGQLKILLKSVFDQWNNHKVAFDEINTYLMEARYSLSRFRLLTGSLEAVQVQVDNLQ
NLQDDLEKQEKNLQRFGSITNQLLKECHPPVTETLTNTLKDVNMRWNNLLEEIAEQLHSS
KALLQLWQRYKDYSQQCASTVQQQEDRTNELLKAATNKDIADDEAATWIQDCNDLLKGLG
IVKDSLFVLHELGEQLKQQVDASAASAIQSDQLSLSQHLCALEQALCKQQTTLQQKVGVL
DYETFTKSLEALEAWIVEAEDILQGQDPSHSSDLSTIQERMEELKGQMLKFSSMVPDLDR
LNELGYRLPLNDKEIKRMQNLNRRWSLISSQTTERFSKLQSFLLQHQTFLEKCETWMEFL
VQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDE
FNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPVSALGS
VPIPLQQARTLFDEVQFKEKVFLRQQGSYILTVEAGKQLLLSADSGAEAALQAELTEIQE
KWKSASVRLEEQKKKLAFLLKDWENCENGIADSLEKLRTFKKKLSQPLPDHHEELHAEQM
RCKELENVAGSWTDDMAQLTLLKDTLCAYISADDISILNERMELLQRQWEELCHQLSLRR
QQVSERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILIEDMIEKLKKDYQEEIAVAQEN
KIQLQQMGERLARASHESKASEIEYKLGKVNDRWQHLLDLMAARVKKLKETLVAVQQLDK
NMSSLRTWLAHIESELAKPIVYDSCDSDEIQKKLTEQQELQRDIEKHSTGVASVLNLCEV
LLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFE
DWLKISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRT
DSACSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLT
NIEHFSECDVQAKIKQLKAFQQEISLNHNKIEHIIAQGEQLIEKSEPLDAAVIEEELDEL
RRYCQEVFGRVERYHKKLIRLPLPDDDHDLSDRELELDDSAALSDLHWRDTSADSVLSPQ
PSSNPSLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAVSRTLPSEDEEGQD
DKDFYLRGAVGLSGAPSALESQIRQLDKALDESRFQMQQTENIIRSKTPTGPELDSSYRG
YMKLLGECSGSIDSVKRLEHKLREEEENFPGFVNLNSTETQTAGVIDRWELIQAQALSKE
LRMKQNLQKWQQFNSDLNNIWTWLGETEEELEQLQRLELSTDIQAIELQIKKLKELQKAV
DHRKALILSINLCSSEFTQTDSEKSQDLQDRLSQMNGRWDHVCSLLEEWRGLLQDALMQC
QDFHEMSHGLLLMLENIDRRKNEIVPIDSNQDAETLQDHHKQLMQIRHELLESQLKVASL
QDMSCQLLVNAEGTDCLEAKEKVHVIGNRLKLLLKEVSRHIKELEKLLDMSSSQQDLSSW
SSADELDTSGSVSPTSGRSTPNRQRTPRGKCSLSQPGPSVNSPHSRSIKGGSDSSLSEPR
PARSGRAFLFRVLRAALPLQLLLLLLIGLACLVPMSEEDYSCALSNNFARSFHPMLRYTN
GPPPL
Download sequence
Identical sequences 9615.ENSCAFP00000000701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]