SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9615.ENSCAFP00000015376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9615.ENSCAFP00000015376
Domain Number 1 Region: 864-996
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-20
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 614-728
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000033
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9615.ENSCAFP00000015376
Sequence length 1156
Comment (Canis familiaris)
Sequence
LEFLRNTFINASDDLPKIILVLSLICTVGAFLNLHLKDFPIPLPVILFLIGCSFEILSFT
SEQVQAYADAIQWMSPKLVFDMFTPIIIFNVAFDMDVYMLQKLFWQILLITIPGFLMNYT
FILWYLASANKLFLKNTPWLLFSAILVSSDPMLTAAAIRDLGLSRSLVNLINGESLMTSI
MSLIIFSGIEEINVNLQKKNHSITLDILLELWFYFLASFLFGILSSKLIQLWMSTVFGED
VNHISLSSSILYFIFFICEIVGMSGIFTLAIMGLFLNSTSFKPGVEVLLLDKCRFWNCLS
FVAFLMVFTFIGLLIPAHTYLYVSFYDIYYSLNIYFTLIVLRLLVFLLLSPLLSRFGHGF
SWRWAFIMVWSEMKGTPNINMALLLAYSDLSFGSEREKSQILFHGVSVCLVTLIVNRFIL
PIAVSKLGLHDVTSTKYKSLHCTFQHFQELTKSAASALKFDKDLANADWNMVEKAIRLQN
PYALSQGDTTEHQKVKCLDCNREIDETLNIEAMELANRRLLSAQIASYQRQYRNETLSQS
AAQVLVGAAGSFGEKKEKYMSPETIKHYSESKKLLAFIRKVLLNWVYNTKKEKGIPSRYY
FLRVCHKIVFTDEFEYVGYLVTLMNMFPIIISWIPKLSDIYEHELRHSNYSFLVLYIMEA
LLKMAAMRKEYFLHAWNVFELVITLVGIIDIILIETNSITYTFDFILTVVFIKIVRFLRI
LRILKLITPKLLQIIDQKMSHQQSFQYAILKGYVQGEADIMTIIDQISTSKHVKQVLLRR
ITKNTGNAMKELGYLEYDHPEIAVTMKTKEEINVMLNLAREIVRVFKSKGIIHKIESTEI
NKLIMAKKKEILDFQPVIKPLTVVEALHHIPWLDKDKEYITFIQKRARIVTFDCGNDIFE
EGDEPKGIYIIISGMVKLQRSKPSFGIDQMESEEKDYQMNYTDFLISGEIIGELNCLTNK
PMTYSATCKTVVETCFIPKNYLYEAFEQCSPHIEYKMWLKLGLSITAKKIREHLSYEDWN
YKMQLKLCNVSVKDIPKNIKTGIYDETVIYVILIHGAVEDCQLRKAYKAPSLIPITCYQV
QGTEDFTKVMIVQTSVDLKNFRWNTRKYVPSRKPSLPTSTTRLYKEGLQFETNIEIQQPS
GLLDSIKEEMDFYTVT
Download sequence
Identical sequences 9615.ENSCAFP00000015376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]