SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000002803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000002803
Domain Number 1 Region: 862-984
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-16
Family cAMP-binding domain 0.018
Further Details:      
 
Domain Number 2 Region: 613-726
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000126
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000002803
Sequence length 1177
Comment (Felis catus)
Sequence
MGGFSRNYISSSEDLPEIILILSLICTVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSRSLTNLINGESLMTSI
MSLIMFNSIEDINGNLQKGNNSLVFDILFGLWSYFLASFLFGILSSKLIQLWMATVFGDD
VNHISLSLSILYLIFFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFWNCLSFV
AFLMVFTFTGLLIPAHTYLYISFSDIYYSLNIYFTLIVLXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLFHGVSVCLVTLIVNRFILPM
AVSKLGVLHDVTSTKYKSLYCTFQHFQELTKSAASALKFDKDLANADWNMVEKAIVLQNP
YAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASYQRQYTNETLSQSA
AQVLVGAVGSFGEKKGEYMSPETIKTYSESKKLLAFIRKVLLNWVYNTKKEKGIPSRHCF
LQSCHKIVFTNEFEYVGYLVIMMNMFPVTISWIPELNDIYEYELEHSNYLFLTFYIMEAL
LKMTAMRKEYFSHTNLFELTITLVGIIDVILIETNYITYTFEFIQTVIFFKIVRFFRILR
ILKLITPKLLQIIDKKMSHQLSFKYAILKGYIQGEADIMTIIDQISSSKQVKQILLRRIM
KNTGHALKELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LIMAKKREILDFQPVIKPLTVEEALYNIPWLDKEKDHISFIQERARVVTFDCGNDIFEEG
DEPKGIYIIISGMVKLQRSKPGLGIDQMLWESEENDDQITYTDFVISGEIIGELNCLTNK
PMICSATCKTVVETSAIPKNQKIEDLEPFAIHMGNKRGGKLGRAFSAINLREKGCEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQ
GTEDFTKVMIVQTFVDVKKFRWNTRKYVPSHKASLPTTPTXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGQ
Download sequence
Identical sequences 9685.ENSFCAP00000002803 ENSFCAP00000002803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]