SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000016249 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000016249
Domain Number 1 Region: 41-309
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-38
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Domain Number 2 Region: 306-399,430-494
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.37e-23
Family cAMP-binding domain 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000016249
Sequence length 574
Comment (Equus caballus)
Sequence
RQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVG
NLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKM
KYLKSWFVVDFISSIPVDYIFLIVETRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLI
RYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINN
MVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATA
LIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSE
PLREVSLPTARPGKGAGLPLGMYFIQHGVVSVLHKATKGEPNLADALFRKGMGWRDTKDG
RHGRPFVATAQRWPTLTPAVLAEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP
MMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGENEIIQQIVQHDREMAHCAHRVQAA
ASATPTPTPVIWTPLIQAPLQAAAATTVAIALTH
Download sequence
Identical sequences F6Z9K8
ENSECAP00000016249 ENSECAP00000016249 9796.ENSECAP00000016249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]