SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000007080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9823.ENSSSCP00000007080
Domain Number - Region: 204-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0392
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000007080
Sequence length 341
Comment (Sus scrofa)
Sequence
MVPAADALLWALLLLSLGPRAAAGAQGLTSTATQRDSFRFGGPLTRTYRTTARSRIPPRV
RVTMEDEDDVVAVADRLAGPAAAELLASTVSTGGQSRLSAEEDGSLEEGVVIYARRNDTS
LETPITTSNTAGGPTPIFTANGQDPEIKMSSSPLPSTWKAAADLSASDNTLNQWSRAGST
RNRWPPPSPTAMPAPEDLQLVLMPWGPWHCHCKSGTMSRTRAGKLHGLSGRLRVGALSQL
RTEHRPCTYHQCPCNRDREECPLDKGLCPDTSCTTTQTTTRATTTTTFPPLVPRLRPTPF
PSPGPSPALAFWKRVRIGLEDIWNSLSSVFTEMQPINRNQR
Download sequence
Identical sequences ENSSSCP00000007080 ENSSSCP00000007080 XP_001929699.1.46622 9823.ENSSSCP00000007080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]