SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000008226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000008226
Domain Number 1 Region: 22-142
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-29
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 168-319
Classification Level Classification E-value
Superfamily TPR-like 2.46e-21
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000008226
Sequence length 327
Comment (Sus scrofa)
Sequence
MGGSARNPGALQRDVAPSQSLYQRLSQRMLDISGDRGVLKDVIREGTGELVTPDASVLVK
YSGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGT
LGCPPLIPPNTTVLFEIELLDFLDSAESDKFCALSVDQQDQFPLEKVLKVAATEREFGNY
LFRQNRFYDAKMRYKRALVLLHRRSAPSEEQHLVETAKLLVLLNLSFVYLKLERPAMALR
YGEQALIIDQKNAKALFRCGQACLLMTEYLKARDFLVRAQKEQPFNHDINNELKKLASYY
RDYVDKEKEMCHRMFAPCDSGPAAGEN
Download sequence
Identical sequences ENSSSCP00000008226 9823.ENSSSCP00000008226 ENSSSCP00000008226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]