SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000010441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000010441
Domain Number 1 Region: 127-198
Classification Level Classification E-value
Superfamily RILP dimerisation region 3.53e-18
Family RILP dimerisation region 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000010441
Sequence length 204
Comment (Sus scrofa)
Sequence
MEEPPLREEEEEGDEAGPEGALGKSPFQLTAEDVYDISYVMGRELMALGSDPRVTQLQFK
IVRVLEMLETLVNEGNLTVEELRMERDNLRTEVEGLRREGSAAGGEVNLGPDKMVVDLTD
PNRPRFTLQELRDVLQERNKLKSQLLVAQEELQCYKSGLIPPREGPGGRREKDTLVARAN
NARSNKEEKTIIRKLFSFGSGKQT
Download sequence
Identical sequences F1RFJ9
ENSSSCP00000010441 XP_013838240.1.46622 9823.ENSSSCP00000010441 ENSSSCP00000010441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]