SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000011243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000011243
Domain Number 1 Region: 354-404,442-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000165
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 592-692
Classification Level Classification E-value
Superfamily EF-hand 0.0000336
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000011243
Sequence length 805
Comment (Sus scrofa)
Sequence
MKAVESPEAQELHKLGNGAWDNPAYSSPPSLHGTLRICTVSSVVPPQPQSKQPEDGPQEK
APKTLVSSCCLQICRSIRGLWGTSLTENTAENRELYVKTTLRELLVYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTPSDTGVSFQTIGSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENLLLGVPRLRQLRVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGLF
NGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDFPGSRQASAEALRDLQEGLWLDRGTRV
VFVDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIIGCEIIFC
IFIFYYVVEEILELHIHRLHYLCSIWNILDLVVILLSVTAVGFHIFRTLEVNRLIGKLLQ
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDVQKVLQSGKQEIQFEDFTNTLRELGHTEHEIMELTAAFTRFDQDGNRILDEKEQEQ
MQQDLEEKRVALNTEIENLGRSIESNPPGELSPETAKAGGWISGEEFYMLTRRVLQLETV
LEGVMSQVDAVGSKLKMLERRGQLAPSPGMGEEGIWEQLQAATSVTPDPWELQGRQEGGF
PCEREGGAREERRLSPWEDYSVAEA
Download sequence
Identical sequences ENSSSCP00000011243 9823.ENSSSCP00000011243 ENSSSCP00000011243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]