SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9823.ENSSSCP00000011515 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9823.ENSSSCP00000011515
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.23e-48
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9823.ENSSSCP00000011515
Sequence length 252
Comment (Sus scrofa)
Sequence
FYILQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIR
QVHNSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWI
SAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGSNML
SAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAK
EKQNAKKAQETK
Download sequence
Identical sequences 9823.ENSSSCP00000011515 ENSSSCP00000011518 ENSSSCP00000011518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]