SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000002909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000002909
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily FKBP-like 1.87e-28
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 167-314
Classification Level Classification E-value
Superfamily TPR-like 3.8e-21
Family Tetratricopeptide repeat (TPR) 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000002909
Sequence length 326
Comment (Bos taurus)
Sequence
MSSSRPLNGLSRLDAEDRSPYQRLSQRMLDISGDRGVLKDVIREGAGELVTPDASVLVKY
SGYLEHMDKPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPTYAYGTL
GCPPLIPPNTTVLFEIELLDFLDSAESDKFCALSAEQQSQFPLQKVLKVAATEREFGNYL
FRQNRFYDAKVRYKRALLLLHRRTAPPEEQHLVETAKLLVFLNLSFTYLKLERPTMALRY
GEQALIIDRKNAKALFRCGQACLLMTEYQKARDFLVRAQREQPFNHDINNELKKLASYYR
DYMDKEREMCHRMFASGDNGSTVGEN
Download sequence
Identical sequences A6QQ71
ENSBTAP00000002909 NP_001095679.1.59421 NP_001095679.1.76553 ENSBTAP00000002909 9913.ENSBTAP00000002909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]