SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000006543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000006543
Domain Number 1 Region: 25-260
Classification Level Classification E-value
Superfamily L domain-like 6.89e-43
Family Ngr ectodomain-like 0.00051
Further Details:      
 
Domain Number 2 Region: 261-365
Classification Level Classification E-value
Superfamily Immunoglobulin 5.1e-17
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000006543
Sequence length 510
Comment (Bos taurus)
Sequence
MAPGAPALLLLSLLSLPGLPPRAAACPAACRCYSATVECGALRLRVVPPGIPPGTQTLFL
QDNSIARLEPGILAPLASLRHLYLHNNSLHALESGAFRTQSRLLELALTGNRLRGLRVGA
FAGLAQLRVLYLAGNQLVQLLDFTFLHLQRLQELHLQENSIELLEDQALAGLSSLALLDL
SRNQLGTISREALQPLASLQVLRLTENPWRCDCALHWLGAWIKEGGQRLLSSRDKKILCA
EPPRLALQSLLEVSGSSLICIPPSVHVEPLEVTANLGEDLRVACQASGYPQPLVTWRKVA
QPREGAPRAQAQPEVGWRGTGGLGASDTGSGMLFLTNITLAHAGKYECEASNAGGAARVP
FQLLVNVSRQQQLAPAPPPAGGPVSHEPLPETGSMAFRALGLATQTAIAAAIALLALTAL
LLATMICRRRRRRKKAPGPSGEGALFVNDYSDGPCTFAQLEELRDERGHEMFVIDRSKPL
FAEGPAEAAEAPGVAQGLPLQPPSAYEIHC
Download sequence
Identical sequences A4IFI5
9913.ENSBTAP00000006543 ENSBTAP00000006543 ENSBTAP00000006543 NP_001077147.1.59421 NP_001077147.1.76553 XP_019829150.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]