SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9913.ENSBTAP00000053611 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9913.ENSBTAP00000053611
Domain Number 1 Region: 843-978
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.94e-19
Family cAMP-binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 591-706
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000126
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9913.ENSBTAP00000053611
Sequence length 1093
Comment (Bos taurus)
Sequence
LSIDIFFAALLNQHLKDFPIPLPVILFLLGCSFEMLSFTSDKVQEYADAIQWMDSHLFFN
LFTPVIIFSVAFDMDVYLLHKLFWQIVFITVPGFLINYTLILWYLASVNKLLLKTTPWLL
FSAILVSLDPMLTSSAIKDLGLSRSLVSLINGESLMTSVMSLITFTVIVNIDLSLHKNTI
QSLAYIIMREIWLHLIVSFSFGIVSSKLIQLWMSTVFGEDVNHISLSFSFLYLIFYICEL
TEMSGTFTLVIMGLFLNSTNFKPGVEALILEFWNCLSFVAFLMVFTFTGLLIPAHTYLYI
SFSDIYYSLNIYLTLIMFRLLVFLLLSPLLSRLGHGFSWRWAFIMVWSEMKGTPNINLAL
LLAYFENSYGSEREKSQILFHGVSVSLISLIVNRFILPMAVTKLGLRDVTSTKYKSLYYT
FQHFQELTKSVASALKFDRDLANADWNIVEKTIILQNPYALGQGETKEHQKVKCQHCNKE
IDDNLNIEAMELANRRLLSAQIASYQRQYRSETLSQSAIQVLVGAAGSFGEKMVEYMNAE
TIKNYSESKKILVFTRKVLLNWVYNTKKEKGIPSRHCFLRACHKIVFTDEFEYIGYLVIL
MNMFPIIISCISVLNDIYETELAYANYSFLAFYIMEALLKIAAMRKEYFFHAWNLFELTI
TLVGIIDVMLIETNSINYYIFDLVQIVIIMKIVRFLRILRILKLVTPRLLQILDKRMSHQ
LSFRYAILKGYVQGEADIMTIIDKIASSKQVKQMLLRRVTKNTGHAMKELGYLEYDHPEI
AVTMKTKEEINVMLSLAREIVKVFRLKGILHKIEGSEINKIIMAKKRDILDFQPTYKPLT
VEEALYHIPWLDKDEEHISFIQERSRVVTFDCGNDIFEEGDEPKGIYVIISGMVKLQRSK
PGLGIDQIIWESEEKDYQITYTDFVISGAVIGELNCLTNAPMKYSATCKTVVETCFIPKN
HLYEAFEQFYPHIEYRMWLKLGLSITAKKIREHLSYEDWNYKMQLKLSNIYVKDIPKNTK
TDIYDETVIYVILIHGAVEDCQLRKAYKAPFLIPITCHQIQGTEDFTKVTIVQTSIYSKR
FRWNTRKYIASHK
Download sequence
Identical sequences 9913.ENSBTAP00000053611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]