SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 9986.ENSOCUP00000004000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9986.ENSOCUP00000004000
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.14e-91
Family Carbonic anhydrase 0.00000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9986.ENSOCUP00000004000
Sequence length 355
Comment (Oryctolagus cuniculus)
Sequence
MPVGSLRAAAVLLLGIAQLPPSSTAPRNGSKWTYVGADGERSWFKKYPSCGGRLQSPIDL
HGDTLQYDASLTPLEFQGYNVSADKQFNLTNDGHSVRLNLPPDMYLQGLPSRYTATQLHL
HWGNRNDPYGSEHTVGGKQFAAELHIVHYNSDSYPDISTASNKSEGLAVLAVLIEKGYFN
PYYDRIFSFLRYVKYKGQNVRIPTFNIEELLPEKPAEYYRYRGSLTTPPCYPSVLWTVFR
NPVTISQEQLLALQTALYFTRADDPAPREMINNFRPIQNFGVRLVHASFQEVQILPGTGL
SVGIILSVALAGVLGICIVLAVCIWFFRRKKGSKKGDNKGVIYKPAIKMETEAHA
Download sequence
Identical sequences G1SM71
ENSOCUP00000004000 ENSOCUP00000004000 9986.ENSOCUP00000004000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]